Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G08420-AT2G27210
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):BRI1 suppressor 1 (BSU1)-like 2
Function (paralog2):BRI1 suppressor 1 (BSU1)-like 3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.49568778963706
Log2 mRNA fold difference:-0.36308891166828
Log2 TE fold difference:0.00077919383974495
Sequences
Protein sequence

MDEDSSMVADNDQDREFQSLDGGQSPSPMERETPQQMNDQSPPPEGGSVPTPPPSDPNPA
TSQQQAAAVVGQEQQPALVVGPRCAPTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDEG
TPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRLTP
FGEPPTPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGP
RYGHVMALVGQRYLMAIGGNDGKRPLADVWALDTAAKPYEWRKLEPEGEGPPPCMYATAS
ARSDGLLLLCGGRDANSVPLASAYGLAKHRDGRWEWAIAPGVSPSSRYQHAAVFVNARLH
VSGGALGGGRMVEDSSSVAVLDTAAGVWCDTKSVVTSPRTGRYSADAAGGDASVELTRRC
RHAAAAVGDLIFIYGGLRGGVLLDDLLVAEDLAAAETTYAASHAAAAAATNSPPGRLPGR
YGFSDERNRELSESAADGAVVLGSPVAPPVNGDMHTDISPENALLPGTRRTNKGVEYLVE
ASAAEAEAISATLAAAKARQVNGEVELPDRDCGAEATPSGKPTFSLIKPDSMGSMSVTPA
GIRLHHRAVVVAAETGGALGGMVRQLSIDQFENEGRRVSYGTPESATAARKLLDRQMSIN
SVPKKVIAHLLKPRGWKPPVRRQFFLDCNEIADLCDSAERIFASEPTVLQLKAPIKIFGD
LHGQFGDLMRLFDEYGSPSTAGDISYIDYLFLGDYVDRGQHSLETISLLLALKVEYQHNV
HLIRGNHEAADINALFGFRIECIERMGERDGIWVWHRINRLFNWLPLAASIEKKIICMHG
GIGRSINHVEQIENIQRPITMEAGSIVLMDLLWSDPTENDSVEGLRPNARGPGLVTFGPD
RVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLFSATNYCGTANNAGAILVLGRDLV
VVPKLIHPLPPALSSPETSPERHIEDTWMQELNANRPATPTRGRPQNSNDRGGSLAWM

MDLDSSMVPENDQDPIATSENQSPMEEKEEASEQQTGSESESASLTPSLPPPSQQQQQQQ
QQPQVTAVVGPRCAPTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSSYIGPRLIL
FGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCYDVLSNKWSRLTPYGEPPSPRAAH
VATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQ
RYLMAIGGNDGKRPLADVWALDTAAKPYEWRKLEPEGEGPPPCMYATASARSDGLLLLCG
GRDANSVPLASAYGLAKHRDGRWEWAIAPGVSPSARYQHAAVFVNARLHVSGGALGGGRM
VEDSSSVAVLDTAAGVWCDTKSVVTSPRTGRYSADAAGGDASVELTRRCRHAAAAVGDLI
FIYGGLRGGVLLDDLLVAEDLAAAETTSAASHAAAAAAATNTPPGRSPGRYGFSDERTGE
LPESAPDAVVLGSPVAPPVNGDMYTDISTENAMVPGIRRTSKGVEYLVEASAAEAEAISA
TLAAAKARQVNGEVELPDRDRGAEATPSGKPSLSLIKPDSAVPNSVIPAGVRLHHRAVVV
AAETGGALGGMVRQLSIDQFENEGRRVSYGTPESATAARKLLDRQMSINSVPKKVVAHLL
KPRGWKPPVRRQFFLDCNEIADLCDSAERIFSSEPTVLQLKAPIKIFGDLHGQFGDLMRL
FDEYGSPSTAGDISYIDYLFLGDYVDRGQHSLETITLLLALKVEYQHNVHLIRGNHEAAD
INALFGFRIECIERMGERDGIWVWHRINRLFNWLPLAALIEKKIICMHGGIGRSINHVEQ
IENIQRPITMEAGSIVLMDLLWSDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDL
QLIVRAHECVMDGFERFAQGHLITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPP
AITSPETSPERHIEDTWMQELNVNRPPTPTRGRPQNPNDRGSLAWI

www.000webhost.com

Other information
Ka divergence:-0.258997KaKs divergence:-0.287607
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):3057Length 2 (bp):3021Length divergence:-0.006
MFE 1 (kcal):-1087.69MFE 2 (kcal):-1048.7MFE divergence-0.018