Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G08880-AT1G54690
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Histone superfamily protein
Function (paralog2):gamma histone variant H2AX

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.82524010242857
Log2 mRNA fold difference:-0.89134753416039
Log2 TE fold difference:0.056708678050569
Sequences
Protein sequence

MSTGAGSGTTKGGRGKPKATKSVSRSSKAGLQFPVGRIARFLKSGKYAERVGAGAPVYLS
AVLEYLAAEVLELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGSVTIANGGVLPNIH
QTLLPSKVGKNKGDIGSASQEF

MSSGAGSGTTKGGRGKPKATKSVSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLS
AVLEYLAAEVLELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGSVTIANGGVLPNIH
QTLLPSKVGKNKGDIGSASQEF

Other information
Ka divergence:-1KaKs divergence:-1
GC content 1 (%):50GC content 2 (%):47GC content divergence:-0.031
Length 1 (bp):429Length 2 (bp):429Length divergence:0
MFE 1 (kcal):-136.9MFE 2 (kcal):-126.57MFE divergence-0.039