Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G08890-AT1G08900
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Major facilitator superfamily protein
Function (paralog2):Major facilitator superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.4721479736407
Log2 mRNA fold difference:-1.3204494407601
Log2 TE fold difference:1.8723425192509
Sequences
Protein sequence

MESGSMKTPLVNNQEEARSSSSITCGLLLSTSVAVTGSFVYGCAMSYSSPAQSKIMEELG
LSVADYSFFTSVMTLGGMITAAFSGKIAAVIGRRQTMWIADVFCIFGWLAVAFAHDKMLL
NIGRGFLGFGVGLISYVVPVYIAEITPKAFRGGFSFSNQLLQSFGISLMFFTGNFFHWRT
LALLSAIPCGIQMICLFFIPESPRWLAMYGRERELEVTLKRLRGENGDILEEAAEIRETV
ETSRRESRSGLKDLFNMKNAHPLIIGLGLMLLQQFCGSSAISAYAARIFDTAGFPSDIGT
SILAVILVPQSIIVMFAVDRCGRRPLLMSSSIGLCICSFLIGLSYYLQNHGDFQEFCSPI
LIVGLVGYVLSFGIGLGGLPWVIMSEVFPVNVKITAGSLVTVSNWFFSWIIIFSFNFMMQ
WSAFGTYFIFAGVSLMSFVFVWTLVPETKGRTLEDIQQSLGQLS

MESERLESHLLNKQEEEASSFTSGLLLSTSVVVAGSFCYGCAMSYSSPAQSKIMEELGLS
VADYSFFTSVMTLGGMITAVFSGKISALVGRRQTMWISDVCCIFGWLAVAFAHDIIMLNT
GRLFLGFGVGLISYVVPVYIAEITPKTFRGGFSYSNQLLQCLGISLMFFTGNFFHWRTLA
LLSAIPSAFQVICLFFIPESPRWLAMYGQDQELEVSLKKLRGENSDILKEAAEIRETVEI
SRKESQSGIRDLFHIGNAHSLIIGLGLMLLQQFCGSAAISAYAARIFDKAGFPSDIGTTI
LAVILIPQSIVVMLTVDRWGRRPLLMISSIGMCICSFFIGLSYYLQKNGEFQKLCSVMLI
VGLVGYVSSFGIGLGGLPWVIMSEIFPVNVKITAGSLVTMSNWFFNWIIIYSFNFMIQWS
ASGTYFIFSGVSLVTIVFIWTLVPETKGRTLEEIQTSLVRLS

www.000webhost.com

Other information
Ka divergence:-0.0727362KaKs divergence:0.999648
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1395Length 2 (bp):1389Length divergence:-0.002
MFE 1 (kcal):-398.22MFE 2 (kcal):-400.44MFE divergence0.003