Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G08970-AT1G54830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):nuclear factor Y, subunit C9
Function (paralog2):nuclear factor Y, subunit C3

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.3408933781116
Log2 mRNA fold difference:-0.26271788891049
Log2 TE fold difference:-0.068317448674532
Sequences
Protein sequence

MDQQDHGQSGAMNYGTNPYQTNPMSTTAATVAGGAAQPGQLAFHQIHQQQQQQQLAQQLQ
AFWENQFKEIEKTTDFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEMFILELTL
RSWNHTEENKRRTLQKNDIAAAVTRTDIFDFLVDIVPREDLRDEVLGSIPRGTVPEAAAA
GYPYGYLPAGTAPIGNPGMVMGNPGGAYPPNPYMGQPMWQQQAPDQPDQEN

MDQQGQSSAMNYGSNPYQTNAMTTTPTGSDHPAYHQIHQQQQQQLTQQLQSFWETQFKEI
EKTTDFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEMFILELTLRSWNHTEENK
RRTLQKNDIAAAVTRTDIFDFLVDIVPREDLRDEVLGGVGAEAATAAGYPYGYLPPGTAP
IGNPGMVMGNPGAYPPNPYMGQPMWQQPGPEQQDPDN

Other information
Ka divergence:0.368872KaKs divergence:0.160804
GC content 1 (%):51GC content 2 (%):48GC content divergence:-0.03
Length 1 (bp):696Length 2 (bp):654Length divergence:-0.031
MFE 1 (kcal):-247.19MFE 2 (kcal):-207.7MFE divergence-0.087