Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G08990-AT1G54940
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):plant glycogenin-like starch initiation protein 5
Function (paralog2):plant glycogenin-like starch initiation protein 4

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.6830792555268
Log2 mRNA fold difference:-1.9016040132037
Log2 TE fold difference:-0.50782871663153
Sequences
Protein sequence

MGAKSKSSSTRFFMFYLILISLSFLGLLLNFKPLFLLNPMIASPSIVEIRYSLPEPVKRT
PIWLRLIRNYLPDEKKIRVGLLNIAENERESYEASGTSILENVHVSLDPLPNNLTWTSLF
PVWIDEDHTWHIPSCPEVPLPKMEGSEADVDVVVVKVPCDGFSEKRGLRDVFRLQVNLAA
ANLVVESGRRNVDRTVYVVFIGSCGPMHEIFRCDERVKRVGDYWVYRPDLTRLKQKLLMP
PGSCQIAPLGQGEAWIQDKNRNLTSEKTTLSSFTAQRVAYVTLLHSSEVYVCGAIALAQS
IRQSGSTKDMILLHDDSITNISLIGLSLAGWKLRRVERIRSPFSKKRSYNEWNYSKLRVW
QVTDYDKLVFIDADFIIVKNIDYLFSYPQLSAAGNNKVLFNSGVMVLEPSACLFEDLMLK
SFKIGSYNGGDQGFLNEYFVWWHRLSKRLNTMKYFGDESRHDKARNLPENLEGIHYLGLK
PWRCYRDYDCNWDLKTRRVYASESVHARWWKVYDKMPKKLKGYCGLNLKMEKNVEKWRKM
AKLNGFPENHWKIRIKDPRKKNRLSQ

MGTKTHNSRGKIFMIYLILVSLSLLGLILPFKPLFRITSPSSTLRIDLPSPQVNKNPKWL
RLIRNYLPEKRIQVGFLNIDEKERESYEARGPLVLKNIHVPLDHIPKNVTWKSLYPEWIN
EEASTCPEIPLPQPEGSDANVDVIVARVPCDGWSANKGLRDVFRLQVNLAAANLAVQSGL
RTVNQAVYVVFIGSCGPMHEIFPCDERVMRVEDYWVYKPYLPRLKQKLLMPVGSCQIAPS
FAQFGQEAWRPKHEDNLASKAVTALPRRLRVAYVTVLHSSEAYVCGAIALAQSIRQSGSH
KDMILLHDHTITNKSLIGLSAAGWNLRLIDRIRSPFSQKDSYNEWNYSKLRVWQVTDYDK
LVFIDADFIILKKLDHLFYYPQLSASGNDKVLFNSGIMVLEPSACMFKDLMEKSFKIESY
NGGDQGFLNEIFVWWHRLSKRVNTMKYFDEKNHRRHDLPENVEGLHYLGLKPWVCYRDYD
CNWDISERRVFASDSVHEKWWKVYDKMSEQLKGYCGLNKNMEKRIEKWRRIAKNNSLPDR
HWEIEVRDPRKTNLLVQ

www.000webhost.com

Other information
Ka divergence:0.0116562KaKs divergence:-0.134654
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1701Length 2 (bp):1674Length divergence:-0.008
MFE 1 (kcal):-527.07MFE 2 (kcal):-499.39MFE divergence-0.027