Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G09000-AT1G54960
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NPK1-related protein kinase 1
Function (paralog2):NPK1-related protein kinase 2

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.8262690771538
Log2 mRNA fold difference:0.86491833865042
Log2 TE fold difference:-2.6493665698606
Sequences
Protein sequence

MQDFFGSVRRSLVFRPSSDDDNQENQPPFPGVLADKITSCIRKSKIFIKPSFSPPPPANT
VDMAPPISWRKGQLIGRGAFGTVYMGMNLDSGELLAVKQVLIAANFASKEKTQAHIQELE
EEVKLLKNLSHPNIVRYLGTVREDDTLNILLEFVPGGSISSLLEKFGPFPESVVRTYTRQ
LLLGLEYLHNHAIMHRDIKGANILVDNKGCIKLADFGASKQVAELATMTGAKSMKGTPYW
MAPEVILQTGHSFSADIWSVGCTVIEMVTGKAPWSQQYKEVAAIFFIGTTKSHPPIPDTL
SSDAKDFLLKCLQEVPNLRPTASELLKHPFVMGKHKESASTDLGSVLNNLSTPLPLQINN
TKSTPDSTCDDVGDMCNFGSLNYSLVDPVKSIQNKNLWQQNDNGGDEDDMCLIDDENFLT
FDGEMSSTLEKDCHLKKSCDDISDMSIALKSKFDESPGNGEKESTMSMECDQPSYSEDDD
ELTESKIKAFLDEKAADLKKLQTPLYEEFYNSLITFSPSCMESNLSNSKREDTARGFLKL
PPKSRSPSRGPLGGSPSRATDATSCSKSPGSGGSRELNINNGGDEASQDGVSARVTDWRG
LVVDTKQELSQCVALSEIEKKWKEELDQELERKRQEIMRQAGLGSSPRDRGMSRQREKSR
FASPGK

MVFAKSQSPPNNSTVQIKPPIRWRKGQLIGRGAFGTVYMGMNLDSGELLAVKQVLITSNC
ASKEKTQAHIQELEEEVKLLKNLSHPNIVRYLGTVREDETLNILLEFVPGGSISSLLEKF
GAFPESVVRTYTNQLLLGLEYLHNHAIMHRDIKGANILVDNQGCIKLADFGASKQVAELA
TISGAKSMKGTPYWMAPEVILQTGHSFSADIWSVGCTVIEMVTGKAPWSQQYKEIAAIFH
IGTTKSHPPIPDNISSDANDFLLKCLQQEPNLRPTASELLKHPFVTGKQKESASKDLTSF
MDNSCSPLPSELTNITSYQTSTSDDVGDICNLGSLTCTLAFPEKSIQNNSLCLKSNNGYD
DDDDNDMCLIDDENFLTYNGETGPSLDNNTDAKKSCDTMSEISDILKCKFDENSGNGETE
TKVSMEVDHPSYSEDENELTESKIKAFLDDKAAELKKLQTPLYEEFYNGMITCSPICMES
NINNNKREEAPRGFLKLPPKSRSPSQGHIGRSPSRATDAACCSKSPESGNSSGAPKNSNA
SAGAEQESNSQSVALSEIERKWKEELDQELERKRREITRQAGMGSSPRDRSLSRHREKSR
FASPGK

www.000webhost.com

Other information
Ka divergence:0.0426303KaKs divergence:0.0826166
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):2001Length 2 (bp):1821Length divergence:-0.047
MFE 1 (kcal):-614.29MFE 2 (kcal):-547.5MFE divergence-0.057