Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G09040-AT1G09050
Species:Arabidopsis
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.15916296680171
Log2 mRNA fold difference:-0.10672873404682
Log2 TE fold difference:-0.00037070914896638
Sequences
Protein sequence

MVLLMGAENNLMEETTAVTEEDSYDDEFPCGDPQVEPRVGDEFQVDIPPMMSATKRAVFL
STPVALDDSSYSFLIGLPVQVMWIDKHRRGQGNGDDNVDMNQSLKSLRAKKSRCSAKIRG
KSDKNSETKKQRSNLEAVPVIPSSSWEDLEVASFVLGLYTFGKNFTQVKNFMENKGIGEI
MLFYYGKFYNSAKYHSWSESRKKRNRKCVFGRTLYSGWRQQQLLTRLMPSIPDEPQKQIL
VDVSKSFAEGTITLEKYVSAVKNLVGLRLLVDAVAIGKEKEDLTVPTSTPMKTKPWFTVS
SKSSLVPGEGDYNSLTSAGIINQLTGCSRLSKARCNDIFWGAVWPRLLARGWHSQQPEDR
GYFKSKDYIVFIVPGVKKFSRQELVKGDHYFDSVSDILTKVVSEPELLENETGGVAAELS
SDKSDEESVPSDSLRHRYLRSPCSNRGTLGMKFTVVDTSLATGGKLCDLRNLNAECLVVS
EPNVRLEVKDSPVLKNSLDSQNVEKSQVRPLDAKNQVDDPMRFTIIDTSVDHCEKSSGFR
RWRYLPSDETKRGHVGADSGIKEEKTLEKVKDPSKRVIKHRSTPRAETNYHAVNSAPYLK
RRRLSACISRESPVSKHIPGDDDTKMTVCLESEQQSICVVQQQTSTCEEMNQDKETVPLV
EHMKLKSDQSKKTGTGPSSLLVEIQETTEIEPSGLNSNTGVDKNCSPEKISTSHEQKPNG
LCSVSKSDKKRASNDLEQKQALELPSISGLNNRSSSNDLGTTQELGSSEQQHGQQNNTDG
PRRQSTRKRPLTTRALEAMESDFLTTKRMKSTTKPEPRKRESSTKKKRSAKACNRNGSAD
LEHRREDRNIFIWKAPTSKPLDQIEDTKPRYLLNEARTESKTLDRIQESRPVLTEYRKLP
PIVLKLPFRRG

MVLLMDGENNLMEETTAVIEEDSYDDEFPCGDPQVEPRVGDEFQVDIPLMMSASKRAVFL
SNPVALDDSTCSFLVGLPVQVMWIDKVGIGQGNGDGNVDMNQSLKSLRAKKGRCSAKIRG
KSDKNSETKKQRLNLEAVPAIPSSSWDDLEVASFVLGLYTFGKNFTQMNNFMENKGIGEI
MLFYYGKFYNSAKYHTWSESRKKRNRKCVYGRKLYSGWRQQQLLTRLMPSIPDEPQKQML
VDVSKSFAEGTITLEKYVSAVKNLVGLRLLVDAVAIGKEKEDLTVPTSTPMKTKPWFTVS
SKSSLVPGEGDYNSLTSAGIINQLTGCSRLSKARCNDIFWGAVWPRLLARGWRSQQPEDR
GYFKSKDYIVFIVPGVKKFSRQELVKGDHYFDSVSDILTKVVSEPELLENETGGVAAENP
SDQSDEESSPSDSLRHRYLRSPCSNRGTLGMKFTVVDTSLATGGKLCDLRNLNAECLVVS
EPKARLEAKDSSVLKNSLDSQNVEKSQVRPLDAKNHVDDPMRFTIVDTSVDHCEKLSGFR
RWRCLPSDDTRRGHVGADSGIKEEKTLEKAKDPSKRVIKPRSTPRAETNYYAVDSAPYLK
RRRLSACISRESPVSKHLPGDNDTKMTICLESEQQSICVVQQQTSTCEEMNQDKEIVPLV
EHMNLKSDQSKKTGTGLSSSLVEIQETTAIEPSGLNSNTGVDKNCSPEKIRTAHELISAE
PKTNGICSVSELDKKRASSDLEQKQVFELPSISGSNNRSPSNDLGTSQEMGSSEQQHNQQ
IKTDGPRRQSTRKRPLTTRALEALESDFLITKRMKSTTKPEPRKHESSTKKKRSAKACNR
NGSADLEHRGEDRSSFTKKSPTSKPLDQIEDSKPSYLLNEARTESKALDQVQESRPVLTE
YRKLPPIVLKLPFRRG

www.000webhost.com

Other information
Ka divergence:-0.0669766KaKs divergence:0.104517
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):2736Length 2 (bp):2751Length divergence:0.003
MFE 1 (kcal):-806.44MFE 2 (kcal):-805.66MFE divergence0