Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G09155-AT1G56250
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):phloem protein 2-B15
Function (paralog2):phloem protein 2-B14

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.841304945056
Log2 mRNA fold difference:2.702542459917
Log2 TE fold difference:0.047527249568353
Sequences
Protein sequence

MMLPEACVATILSFTTPADTISSAAVSSVFRVAGDSDFVWEKFLPTDYCHVISRSTDPHR
IFSSKKELYRCLCESILIDNGRKIFKIEKLSGKISYILSSRDLSITWSDQRHYWSWSPRS
DSRFSEGVQLIMTDWLEIIGKIQTGALSPNTNYGAYLIMKVTSRAYGLDLVPAETSIKVG
NGEKKIKSTYLSCLDNKKQQMERVFYGQREQRMATHEVVRSHRREPEVRDDGWMEIELGE
FETGSGEGDDDKEVVMSLTEVKGYQLKGGIAIDGIEVRPKPLKVRAGTN

MMMLPEACIANILAFTSPADAFSSSEVSSVFRLAGDSDFVWEKFLPSDYKSLISQSTDHH
WNISSKKEIYRCLCDSLLIDNARKLFKINKFSGKISYVLSARDISITHSDHASYWSWSNV
SDSRFSESAELIITDRLEIEGKIQTRVLSANTRYGAYLIVKVTKGAYGLDLVPAETSIKS
KNGQISKSATYLCCLDEKKQQMKRLFYGNREERMAMTVEAVGGDGKRREPKCRDDGWMEI
ELGEFETREGEDDEVNMTLTEVKGYQLKGGILIDGIEVRPKT

Other information
Ka divergence:0.275539KaKs divergence:-0.334942
GC content 1 (%):44GC content 2 (%):41GC content divergence:-0.035
Length 1 (bp):870Length 2 (bp):849Length divergence:-0.012
MFE 1 (kcal):-255.71MFE 2 (kcal):-225.5MFE divergence-0.063