Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G09210-AT1G56340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):calreticulin 1b
Function (paralog2):calreticulin 1a

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.54560997403483
Log2 mRNA fold difference:1.0969916022635
Log2 TE fold difference:-0.68883581969784
Sequences
Protein sequence

MAKMIPSLVSLILIGLVAIASAAVIFEERFDDGWENRWVKSEWKKDDNTAGEWKHTAGNW
SGDANDKGIQTSEDYRFYAISAEFPEFSNKDKTLVFQFSVKHEQKLDCGGGYMKLLSGDV
DQKKFGGDTPYSIMFGPDICGYSTKKVHAILTYNEANHLIKKDVPCETDQLTHVYTFILR
PDATYSILIDNVEKQTGSLYSDWDLLPPKKIKDPSAKKPEDWDEQEYISDPEDKKPDGYD
DIPKEIPDTDSKKPEDWDDEEDGEWTAPTIPNPEYMGEWKPKQIKNPNYKGKWEAPLIDN
PDFKDDPELYVFPKLKYVGLELWQVKSGSLFDNVLICDDPDYAKKLADETWGKLKDAEKA
AFDEAEKKNEEEESKDAPAESDAEDEPEDDEGGDDSDSESKAEETKSVDSEETSEKDATA
HDEL

MAKLNPKFISLILFALVVIVSAEVIFEEKFEDGWEKRWVKSDWKKDDNTAGEWKHTAGNW
SGDANDKGIQTSEDYRFYAISAEFPEFSNKDKTLVFQFSVKHEQKLDCGGGYMKLLSDDV
DQTKFGGDTPYSIMFGPDICGYSTKKVHAILTYNGTNHLIKKEVPCETDQLTHVYTFVLR
PDATYSILIDNVEKQTGSLYSDWDLLPAKKIKDPSAKKPEDWDDKEYIPDPEDTKPAGYD
DIPKEIPDTDAKKPEDWDDEEDGEWTAPTIPNPEYNGEWKPKKIKNPAYKGKWKAPMIDN
PEFKDDPELYVFPKLKYVGVELWQVKSGSLFDNVLVSDDPEYAKKLAEETWGKHKDAEKA
AFDEAEKKREEEESKDAPAESDAEEEAEDDDNEGDDSDNESKSEETKEAEETKEAEETDA
AHDEL

Other information
Ka divergence:-0.347286KaKs divergence:-0.504499
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1275Length 2 (bp):1278Length divergence:0.001
MFE 1 (kcal):-399.74MFE 2 (kcal):-389.26MFE divergence-0.013