Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G09240-AT1G56430
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):nicotianamine synthase 3
Function (paralog2):nicotianamine synthase 4

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.5609132968233
Log2 mRNA fold difference:3.4465770189765
Log2 TE fold difference:-0.56427115595891
Sequences
Protein sequence

MGCQDEQLVQTICDLYEKISKLESLKPSEDVNILFKQLVSTCIPPNPNIDVTKMCDRVQE
IRLNLIKICGLAEGHLENHFSSILTSYQDNPLHHLNIFPYYNNYLKLGKLEFDLLEQNLN
GFVPKSVAFIGSGPLPLTSIVLASFHLKDTIFHNFDIDPSANSLASLLVSSDPDISQRMF
FHTVDIMDVTESLKSFDVVFLAALVGMNKEEKVKVIEHLQKHMAPGAVLMLRSAHGPRAF
LYPIVEPCDLQGFEVLSIYHPTDDVINSVVISKKHPVVSIGNVGGPNSCLLKPCNCSKTH
AKMNKNMMIEEFGAREEQLS

MGYCQDDQLVNKICDLYEKISKLETLKPCEDVDTLFKQLVSTCIPPNPNIDVTKMSENIQ
EMRSNLIKICGEAEGYLEHHFSSILTSFEDNPLHHLNLFPYYNNYLKLSKLEFDLLEQNL
NGFVPRTVAFIGSGPLPLTSVVLASSHLKDSIFHNFDIDPSANMVAARLVSSDPDLSQRM
FFHTVDIMDVTESLKGFDVVFLAALVGMDKKEKVKVVEHLEKHMSPGALLMLRSAHGPRA
FLYPIVEPCDLEGFEVLSVYHPTDEVINSIVISRKLGEDANGVVHDHIDQASDLACNCSK
IHVIMNKKKSIIEEFAGANEEQLT

Other information
Ka divergence:0.17275KaKs divergence:0.987399
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):963Length 2 (bp):975Length divergence:0.006
MFE 1 (kcal):-259.69MFE 2 (kcal):-285.9MFE divergence0.048