Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G09310-AT1G56580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function, DUF538
Function (paralog2):Protein of unknown function, DUF538

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.8183228876293
Log2 mRNA fold difference:-1.992783829014
Log2 TE fold difference:0.30568569608169
Sequences
Protein sequence

MGLVTEEVRAKAEMYTGDEICREKTKCFLKEISMPNGLLPLKDIEEVGYDRESGVVWLKQ
KKSITHKFTEIDKLVSYGTEVTAIVETGKIKKLTGVKAKELLIWVTINEIYTEEPPTKIT
FKTPTTLSRTFPVTAFIVPEEPAKEEPAKEEPAKEKSSEATEAKEAVAIKEAVAVKEAA

MGLVTDEVRARAEKYTGDEICREKTKEFLKEVSMPNGLLPLKDIEEVGYDRETGIVWLKQ
KKSITHKFEAIGKLVSYATEVIAQVEVGKIKKLTGVKAKELLIWVTLNELVLEQPTSSGK
INFRTPTGLSRTFPVSAFVVPEVEKPATEKNNGTTEVKEAVAVTDA

www.000webhost.com

Other information
Ka divergence:0.116269KaKs divergence:0.583297
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):540Length 2 (bp):501Length divergence:-0.037
MFE 1 (kcal):-158.46MFE 2 (kcal):-154.35MFE divergence-0.013