Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G09350-AT1G56600
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):galactinol synthase 3
Function (paralog2):galactinol synthase 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.93720787058056
Log2 mRNA fold difference:0.43575080803811
Log2 TE fold difference:-1.2173499458762
Sequences
Protein sequence

MAPEMNNKLSYGEKKRAYVTFLAGTGDYVKGVVGLAKGLRKTKSKYPLVVAVLPDVPADH
RRQLLDQGCVIKEIQPVYPPDNQTQFAMAYYVLNYSKLRIWKFVEYSKLIYLDGDIQVFE
NIDHLFDLPDGNFYAVKDCFCEKTWSHTPQYKIGYCQQCPDKVTWPESELGPKPPLYFNA
GMFVYEPSLPTYYNLLETLKVVPPTPFAEQDFLNMYFKDIYKPIPPVYNLVLAMLWRHPE
NIELNEAKVVHYCAAGAKPWRFTGQEGNMEREDIKMLVEKWWDIYNDESLDYKNFNVHCG
QKEDVHRKPKTLPQFFTDLSEADVLQCAKAPSAA

MAPEINTKLTVPVHSATGGEKRAYVTFLAGTGDYVKGVVGLAKGLRKAKSKYPLVVAVLP
DVPEDHRKQLVDQGCVVKEIEPVYPPENQTEFAMAYYVINYSKLRIWEFVEYNKMIYLDG
DIQVFDNIDHLFDLPNGQFYAVMDCFCEKTWSHSPQYKIGYCQQCPDKVTWPEAKLGPKP
PLYFNAGMFVYEPNLSTYHNLLETVKIVPPTLFAEQDFLNMYFKDIYKPIPPVYNLVLAM
LWRHPENIELDQVKVVHYCAAGAKPWRFTGEEENMDREDIKMLVKKWWDIYNDESLDYKN
VVIGDSHKKQQTLQQFIEALSEAGALQYVKAPSAA

Other information
Ka divergence:-0.17771KaKs divergence:0.370038
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1005Length 2 (bp):1008Length divergence:0.001
MFE 1 (kcal):-324.9MFE 2 (kcal):-333.09MFE divergence0.012