Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G09390-AT1G56670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):GDSL-like Lipase/Acylhydrolase superfamily protein
Function (paralog2):GDSL-like Lipase/Acylhydrolase superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-1.9227985247131
Log2 mRNA fold difference:-0.91626536680226
Log2 TE fold difference:-1.0295945204743
Sequences
Protein sequence

MATLSLHSHSFLLVLLPFILILRQNLAVAGGCQVPPVIFNFGDSNSDTGGLVAGLGYSIG
LPNGRSFFQRSTGRLSDGRLVIDFLCQSLNTSLLNPYLDSLVGSKFQNGANFAIVGSSTL
PRYVPFALNIQLMQFLHFKSRALELASISDPLKEMMIGESGFRNALYMIDIGQNDIADSF
SKGLSYSRVVKLIPNVISEIKSAIKILYDEGGRKFWVHNTGPLGCLPQKLSMVHSKGFDK
HGCLATYNAAAKLFNEGLDHMCRDLRTELKEANIVYVDIYAIKYDLIANSNNYGFEKPLM
ACCGYGGPPYNYNVNITCGNGGSKSCDEGSRFISWDGIHYTETANAIVAMKVLSMQHSTP
PTPFHFFCGG

MATLFLYSNTFSFFFITLVSLALLILRQPSRAASCTARPVIFNFGDSNSDTGGLVAGLGY
PIGFPNGRLFFRRSTGRLSDGRLLIDFLCQSLNTSLLRPYLDSLGRTRFQNGANFAIAGS
PTLPKNVPFSLNIQVKQFSHFKSRSLELASSSNSLKGMFISNNGFKNALYMIDIGQNDIA
RSFARGNSYSQTVKLIPQIITEIKSSIKRLYDEGGRRFWIHNTGPLGCLPQKLSMVKSKD
LDQHGCLVSYNSAATLFNQGLDHMCEELRTELRDATIIYIDIYAIKYSLIANSNQYGFKS
PLMACCGYGGTPYNYNVKITCGHKGSNVCEEGSRFISWDGIHYTETANAIVAMKVLSMHY
SKPPTPFHFFCRR

www.000webhost.com

Other information
Ka divergence:0.00560364KaKs divergence:-0.87518
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):1113Length 2 (bp):1122Length divergence:0.004
MFE 1 (kcal):-321.22MFE 2 (kcal):-306.03MFE divergence-0.024