Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G09440-AT1G56720
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.82704835604608
Log2 mRNA fold difference:0.11565957777118
Log2 TE fold difference:0.70242141069241
Sequences
Protein sequence

MAGLKIWQAIFITIALIIIVVLSVLSFCLIWKKKSRRSKTLSLPIIQTPVVSKEIKEVRI
EHVVSTSSNFDPQDENNNESDKFLLNLEMEKNRENGLSSSRSGSGKEGYLCVANRSTSSL
YEMATPSPSPLSGLPESHLGWGHWFTLRDLEIATNRFSKENVIGEGGYGVVYRGELVNGS
LVAVKKILNHLGQAEKEFRVEVDAIGHVRHKNLVRLLGYCIEGTNRILVYEYMNNGNLEE
WLHGAMKHHGYLTWEARMKVLTGTSKALAYLHEAIEPKVVHRDIKSSNILIDDRFNAKIS
DFGLAKLLGDGKSHVTTRVMGTFGYVAPEYANTGLLNEKSDVYSFGVLVLEAITGRDPVD
YARPANEVNLVEWLKMMVGSKRLEEVIDPNIAVRPATRALKRVLLTALRCIDPDSEKRPK
MSQVVRMLESEEYPVPREERRVRRTQEENSDTDRSRPVSRSQSKRL

MGGDLKSQLSRESHVFGLKVWEVIGIAVALLIIAILSVLSCCLTSKKKSRRSKTGLPVIQ
TPPVVSKEIREVRVEHVSASNFAPGEGILLTIQDKNNKDSEKVMVHLDMRKKRSSSGRSG
SFHHLEIIDKHSDSAEEVSASSSLYNIATPSPLSGLPESHLGWGHWFTLRDLETATNRFS
KENVIGEGGYGVVYRGELMNGTPVAVKKILNQLGQAEKEFRVEVDAIGHVRHKNLVRLLG
YCIEGTHRILVYEYVNNGNLEQWLHGAMRQHGYLTWEARMKVLIGTSKALAYLHEAIEPK
VVHRDIKSSNILINDEFNAKVSDFGLAKLLGAGKSHVTTRVMGTFGYVAPEYANSGLLNE
KSDVYSFGVVLLEAITGRDPVDYGRPAHEVNLVDWLKMMVGTRRSEEVVDPNIEVKPPTR
SLKRALLTALRCVDPDSDKRPKMSQVVRMLESEEYPIPREDRRRSRTREGSMEINSDTDM
STPVSRSQSKRQ

www.000webhost.com

Other information
Ka divergence:-0.121735KaKs divergence:0.0823283
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1401Length 2 (bp):1479Length divergence:0.027
MFE 1 (kcal):-400.54MFE 2 (kcal):-437.2MFE divergence0.044