Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G09540-AT1G57560
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):myb domain protein 61
Function (paralog2):myb domain protein 50

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.52186516101481
Log2 mRNA fold difference:0.82009722197402
Log2 TE fold difference:-0.27370463743597
Sequences
Protein sequence

MGRHSCCYKQKLRKGLWSPEEDEKLLTHITNHGHGCWSSVPKLAGLQRCGKSCRLRWINY
LRPDLKRGAFSPEEENLIVELHAVLGNRWSQIASRLPGRTDNEIKNLWNSSIKKKLKQRG
IDPNTHKPISEVESFSDKDKPTTSNNKRSGNDHKSPSSSSATNQDFFLERPSDLSDYFGF
QKLNFNSNLGLSVTTDSSLCSMIPPQFSPGNMVGSVLQTPVCVKPSISLPPDNNSSSPIS
GGDHVKLAAPNWEFQTNNNNTSNFFDNGGFSWSIPNSSTSSSQVKPNHNFEEIKWSEYLN
TPFFIGSTVQSQTSQPIYIKSETDYLANVSNMTDPWSQNENLGTTETSDVFSKDLQRMAV
SFGQSL

MKRHSCCYKQKLRKGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLERCGKSCRLRWINY
LRPDLKRGAFSSEEQNLIVELHAVLGNRWSQIAARLPGRTDNEIKNLWNSCIKKKLMKKG
IDPITHKPLSEVGKETNRSDNNNSTSFSSETNQDLFVKKTSDFAEYSAFQKEESNSVSLR
NSLSSMIPTQFNIDDGSVSNAGFDTQVCVKPSIILLPPPNNTSSTVSGQDHVNVSEPNWE
SNSGTTSHLNNPGMEEMKWSEEYLNESLFSTQVYVKSETDFNSNIAFPWSQSQACDVFPK
DLQRMAFSFGGQTL

Other information
Ka divergence:0.299176KaKs divergence:-0.516465
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1101Length 2 (bp):945Length divergence:-0.076
MFE 1 (kcal):-291.92MFE 2 (kcal):-249.9MFE divergence-0.078