Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G09575-AT1G57610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF607)
Function (paralog2):Protein of unknown function (DUF607)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.73900958204542
Log2 mRNA fold difference:-0.44435297435298
Log2 TE fold difference:1.0629269076965
Sequences
Protein sequence

MWSMGLIRRTAMSNAIRASSQRTWLGHGGLRSCVTVKTPSEDEEEKKKEITIAEAKKLMR
LVNVEDMKKKLVGVADRDVVSYSTLLEASQGMGIARSPDEAHVFARVLDDAGVVLIFRDK
VYLHPDKVVDLIRRAMPLDQNPEEDQIKEEFNKLRIMKEEIDVLAHRQVRKILWCGLATS
MVQIGLFFRLTFWEFSWDVMEPITFFATATGIIVGYAYFLMTSRDPTYQDFMKRLFLSRQ
RKLLKSHKFDCERFKELERLFKMTSSCHAAASIRNRVGLELDLEDALQSRRD

MWSVMGLVRRTAMSSTVNKASPVRSLLGGFRCLNVESKEEDEKKDMTVLEAKKLMRLVNV
EDMKKKLIGMGDKEMVTYTTLIEASQGLGIARSLDEAHAFARVLDDAGVILIFRDKVYLH
PHKVVDLIRKAVPLGLNPDDELIREEFDKMRSMKEEIDVLAHQQVRKILWGGLGYSVVQI
GIFVRLTFWEFSWDVMEPITFFTTATGIIVGYAYFLMTSRDPTYQDFMKRLFLSRQRKLL
KSHKFDAERFKELENKWKITSCSSSSCHANASIRNRVGVDLDLEDSLQSHHRD

Other information
Ka divergence:-0.0391443KaKs divergence:-0.509693
GC content 1 (%):43GC content 2 (%):39GC content divergence:-0.049
Length 1 (bp):879Length 2 (bp):882Length divergence:0.002
MFE 1 (kcal):-274.72MFE 2 (kcal):-244.01MFE divergence-0.059