Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G09580-AT1G57620
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):emp24/gp25L/p24 family/GOLD family protein
Function (paralog2):emp24/gp25L/p24 family/GOLD family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.11030821408608
Log2 mRNA fold difference:0.80239061538032
Log2 TE fold difference:-0.96011803536986
Sequences
Protein sequence

MKMTAKMRREFPTAFLLLFLVPVMIPVGEAVWLDVPPTGTKCVSEEIQSNVVVLADYLII
SEDHEVMPTISVKVTSPYGNNLHNMENVTHGQFAFTTQESGNYLACFWADEKSHGNKNVS
INIDWRTGIAAKDWASIAKKEKIEGVELEIRKLEGAVEAIHENILYLRNREADMRTMSEK
TNSRVAWYSIMSLGVCIAVSGFQVLYLKQYFEKKKLI

MKKKMIPTTILLSALIFSLSPICEAVWLTVPHTGSKCVSEEIQSNVIVLADYLVISEEHS
IFPTVSVKVTAPYGTVLHHRENTTNGQFAFTTQESGTYLACFEADAKSHGNKDFSINIDW
KTGIAAKDWDSIARKEKIEGVELEFKKLEGAVEAIHENLIYLRNREAEMRIVSEKTNSRV
AWYSIMSLGICIVVSGLQILYLKQYFEKKKLI

Other information
Ka divergence:0.0211321KaKs divergence:0.352364
GC content 1 (%):46GC content 2 (%):42GC content divergence:-0.045
Length 1 (bp):654Length 2 (bp):639Length divergence:-0.012
MFE 1 (kcal):-199.96MFE 2 (kcal):-161.97MFE divergence-0.105