Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G09600-AT1G57700
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.4437769739117
Log2 mRNA fold difference:2.790486009156
Log2 TE fold difference:-1.3312212892031
Sequences
Protein sequence

MGCNCTKGTRPDNDNVDNSNSIVSNVNVKERRSKPKKTPKKKKKSKSASSSKDNNVGFEE
RSNDNKEASLTLLIPIDAKKDDESEKKVNLERKSSRLVFQRRPTGIEVGANNIGTLQQPK
MTRICSVSNGERGAQVMAGWPSWLASVAGEAINGWIPRKADSFEKLEKIGQGTYSSVYKA
RDLETNQLVALKKVRFANMDPDSVRFMAREIIILRRLDHPNVMKLEGLITSRVSGSMYLI
FEYMEHDLAGLASTPGINFSEAQIKCYMKQLLHGLEHCHSRGVLHRDIKGSNLLLDHNNN
LKIGDFGLANFYQGHQKQPLTSRVVTLWYRPPELLLGSTDYGVTVDLWSTGCILAELFTG
KPIMPGRTEVEQLHKIFKLCGSPSEEYWKISKLPHATIFKPQQPYKRCVAETFKSLPSSA
LALVEVLLAVEPDARGTTASALESEFFTTSPLASDPSSLPKYQPRKEIDVKAQEEEAKRK
KDTSSKQNDSKQVSRESKAVPAPDSNAESLTSIQKRQGQHNQVSNSDKFNPGEDAASFRI
EPLKSGTAKDGHTRYGVSSVNRNGENVMMGSSRSPRKELRTQRSFVQRGTAQLSRFSNSV
AARDGSHFAIANPRWFEDSYNNNNGRQNGGAWSQRLVVKHKEFTKHKESITVNGEKKERM
HCSGPLVSAGGNLDEMLKEHERQIQLAVRKARVDKKTNRGDNRQTQAFLAANGR

MGCICSKGVRTNDDYIETNHVSIGKENPKASKKQSDSEETSVNGNEATLRLIPDDVKDTF
SDEEVEELEEKKESSFEMKSCESVLQKGNVLEIVDNVGPLQPRMSRIGSVSNGDRAAKVI
AGWPSWLVSVAGEAINGWIPRSADSFEKLEMIGQGTYSSVYRARDLETNQIVALKKVRFA
NMDPESVRFMAREIIILRRLNHPNVMKLEGLIISKASGSMYLIFEYMDHDLAGLASTPGI
KFSQAQIKCYMKQLLLGLEHCHSCGVLHRDIKCSNLLLDRNNNLKIGDFGLSNFYRGQRK
QPLTSRVVTLWYRPPELLLGSTDYGVTVDLWSTGCILAELFTGKPLLPGRTEVEQMHKIF
KLCGSPSEEYWRRSRLRHATIFKPQHPYKRCVADTFKDLPSSALALLEVLLAVEPDARGT
ASSALQSEFFTTKPFPSEPSSLPRYQPRKEFDAKLREEEARRRKGSSSKQNEQKRLARES
KAVPAPSANAELLASIQKRLGETNRTSISEKFNPEGDSGNGFRIEPLKGNTAQNPYPIYT
NGDNHPNGSSQLRTQRSYVQRGSGQLSRFSNSMAPTRDGSQFGSMRDAIVNQRWLEDGSE
NFNLSQRLLEKPNGIRKDDPSSSSKESIMGYDGEKRGRIQYSGPLIPGEGNLDEMLKEHE
RQILLAVRRAQADKAKRDDNRQAQTLFPANGR

Other information
Ka divergence:0.142206KaKs divergence:-0.16284
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):2145Length 2 (bp):2079Length divergence:-0.016
MFE 1 (kcal):-635.89MFE 2 (kcal):-630.3MFE divergence-0.004