Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G09640-AT1G57720
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Translation elongation factor EF1B, gamma chain
Function (paralog2):Translation elongation factor EF1B, gamma chain

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.064619301688741
Log2 mRNA fold difference:-0.071474763599065
Log2 TE fold difference:0.11409003721952
Sequences
Protein sequence

MALVLHTYKGNKSAEKALIAAEYVGVQIDVPSDFQMGVTNKTPAFLKMNPIGKVPVLETP
EGSVFESNAIARYVSRLNGDNSLNGSSLIEYAQIEQWIDFSSLEIYASILRWFGPRMGFM
PYSAPAEEGAISTLKRALDALNTHLTSNTYLVGHSITLADIITVCNLNLGFATVMTKKFT
SEFPHVERYFWTVVNQPNFTKVLGDVKQTEAVPPIASKKAAQPAKPKEEPKKKEAPVAEA
PKLAEEEEAPKPKAKNPLDLLPPSPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYS
LWFCDYKYNDENMVSFVTLNKVGGFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGP
EIPKFIMDEVYDMELYEWTKVDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK

MALVMHTYKGNKGANKALIAAEYAGVKIEESADFQMGVTNKSPEFLKMNPIGKVPVLETP
EGPIFESNAIARYVSRKNGDNSLNGSSLIEYAHIEQWIDFSSLEIDANMLKWFAPRMGYA
PFSAPAEEAAISALKRGLEALNTHLASNTFLVGHSVTLADIVTICNLNLGFATVMTKKFT
SAFPHVERYFWTMVNQPEFKKVLGDAKQTEAVPPVPTKKAPQPAKPKEEPKKAAPVAEAP
KPAEEEEAPKPKAKNPLDLLPPSPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSL
WFCDYKYNDENMVSFVTLNKVGGFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPE
IPKFIMDEVYDMELYEWTKVDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK

Other information
Ka divergence:-0.107747KaKs divergence:0.501648
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):1245Length 2 (bp):1242Length divergence:-0.001
MFE 1 (kcal):-390.81MFE 2 (kcal):-406.5MFE divergence0.02