Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G09795-AT1G58080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ATP phosphoribosyl transferase 2
Function (paralog2):ATP phosphoribosyl transferase 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.80616653240367
Log2 mRNA fold difference:0.11101704189331
Log2 TE fold difference:0.68949835318351
Sequences
Protein sequence

MPISIPLNATLQYSSPSSSSSSSSLVPSSPLFSPIPSTTVSLTGIRQRCLRMVTSCVSNA
QKSVLNGATDSVSVVGREQIRLGLPSKGRMAADSLDLLKDCQLFVKQVNPRQYVAQIPQL
PNTEVWFQRPKDIVRKLLSGDLDLGIVGLDIVGEFGQGNEDLIIVHEALNFGDCHLSLAI
PNYGIFENIKSLKELAQMPQWTEERPLRVATGFTYLGPKFMKDNGIKHVTFSTADGALEA
APAMGIADAILDLVSSGTTLKENNLKEIEGGVVLESQAALVASRRALTERKGALETVHEI
LERLEAHLKANGQFTVVANMRGTDAEEVAERVKTQPSLSGLQGPTISPVYCKRDGKVTIE
YYAIVICVPKKALYESVQQLRAVGGSGVLVSPVTYIFHEETPRWSQLLSNLGL

MSLLLPTNLQQYPSSSSFPSSTPILSPPPSTAFSVIVPRRRCLRLVTSCVSTVQSSVATN
GSSPAPAPAAVVVERDQIRLGLPSKGRMAADAIDLLKDCQLFVKQVNPRQYVAQIPQLPN
TEVWFQRPKDIVRKLLSGDLDLGIVGLDTLSEYGQENEDLIIVHEALNFGDCHLSIAIPN
YGIFENINSLKELAQMPQWSEERPLRLATGFTYLGPKFMKENGIKHVVFSTADGALEAAP
AMGIADAILDLVSSGITLKENNLKEIEGGVVLESQAALVASRRALNERKGALNTVHEILE
RLEAHLKADGQFTVVANMRGNSAQEVAERVLSQPSLSGLQGPTISPVYCTQNGKVSVDYY
AIVICVPKKALYDSVKQLRAAGGSGVLVSPLTYIFDEDTPRWGQLLRNLGI

www.000webhost.com

Other information
Ka divergence:-0.0260634KaKs divergence:-0.220045
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1242Length 2 (bp):1236Length divergence:-0.002
MFE 1 (kcal):-384.74MFE 2 (kcal):-366.2MFE divergence-0.025