Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G09840-AT1G57870
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):shaggy-like protein kinase 41
Function (paralog2):shaggy-like kinase 42

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.44729302479173
Log2 mRNA fold difference:-1.1081757660272
Log2 TE fold difference:0.64767028728575
Sequences
Protein sequence

MASSGLGNGVGTSRSAKGLKSSSSSVDWLTRDLAETRIRDKVETDDERDSEPDIIDGAGA
EPGHVIRTTLRGRNGQSRQTVSYISEHVVGTGSFGMVFQAKCRETGEVVAIKKVLQDKRY
KNRELQIMQMLDHPNAVALKHSFFSRTDNEEVYLNLVLEFVPETVNRVARSYSRTNQLMP
LIYVKLYTYQICRALAYIHNSFGLCHRDIKPQNLLVNPHTHQLKICDFGSAKVLVKGEPN
VSYICSRYYRAPELIFGASEYTTAIDIWSTGCVMAELLLGQPLFPGESGVDQLVEIIKVL
GTPTREEIKCMNPNYTEFKFPQIKPHPWHKVFQKRLPPEAVDLLCRFFQYSPNLRCTALE
ACIHPLFDELRDPNTRLPNGRPLPPLFNFKPQELSGIPPEIVNRLVPEHARKQNLFMALH
S

MESHLGNGVGSSRSAKNTKNTSSSVDWLSRDMLEMKIRDKTEADEERDSEPDIIDGVGAE
PGHVITTTLPGRNGQSRQTVSYIAEHVVGTGSFGMVFQAKCRETGEVVAIKKVLQDKRYK
NRELQIMQMLDHPNVVCLKHSFYSRTENEEVYLNLVLEFVPETVNRTARSYSRMNQLMPL
IYVKLYTYQICRGLAYLHNCCGLCHRDIKPQNLLVNPHTHQLKICDFGSAKVLVKGEPNI
SYICSRYYRAPELIFGATEYTTAIDIWSTGCVMAELLLGQPLFPGESGVDQLVEIIKVLG
TPTREEIKCMNPNYTEFKFPQIKPHPWHKVFQKRLPPEAVDLLCRFFQYSPNLRCTAVEA
CIHPFFDELRDPNARLPNGRPLPPLFNFKPQELSGIPPETVDRLVPEHARKQNHFMALHS
CLRIPCREVRMRKIQHYFVRYMI

www.000webhost.com

Other information
Ka divergence:-0.0396376KaKs divergence:0.887709
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1266Length 2 (bp):1332Length divergence:0.025
MFE 1 (kcal):-352.32MFE 2 (kcal):-369.75MFE divergence0.024