Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G09940-AT1G58290
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Glutamyl-tRNA reductase family protein
Function (paralog2):Glutamyl-tRNA reductase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.7514021901828
Log2 mRNA fold difference:3.721123003814
Log2 TE fold difference:-0.86964621715899
Sequences
Protein sequence

MAVSSAFVVTPKLEKLLANHHNPTYSSSPAPLDVIGIRALPMNNRNKRGLIQRARCEISP
SNKAASISALEQLKTSAIDRYTKERSSIVVIGLSIHTAPVEMREKLAIPEAEWPRAIAEL
CGLNHIEEAAVLSTCNRMEIYVLALSQHRGVKEVTEWMSKTSGIPVSEICQHRFLLYNKD
VTQHIFEVSAGLDSLVLGEGQILAQVKQVVKVGQGVNGFGRNISGLFKHAITVGKRVRTE
TNIAAGAVSVSSAAVELALMKLPESSHASSARMLVVGAGKMGKLVIKHLVAKGCTKMVVV
NRSEEKVAAVRNEMPPGVEIIYKPLDEMLSCAAEADVVFTSTASETPLFLKEQVETLPPV
RDARLFVDISVPRNVGSCVAEIDGTRVFNVDDLKEVVAANKEDRVRKAMDAQAIITDESK
HFEAWRDSLETVPTIKKLRGYTERIIAAEIEKSLPKMGIDMNKKMRKTVDDLIRGIVNKL
LHGPMQHLRCDGNDSRTLSETLDNMQALNRMYGLDAEILEEKIRAKVEKK

MAVSSAFVGCPKLETLLNHHNLSPSSSSSSSVSQTPLGLNGVRVLPKNNRTRRGLIQKAR
CELSASSDSASNAASISALEQLKNSAADRYTKERSSIVVIGLSIHTAPVEMREKLAIPEA
EWPRAIAELCGLNHIEEAAVLSTCNRMEIYVLALSQHRGVKEVTEWMSKTSGIPVSEICQ
HRFLLYNKDATQHIFEVSAGLDSLVLGEGQILAQVKQVVKVGQGVNGFGRNISGLFKHAI
TVGKRVRTETNIASGAVSVSSAAVELALMKLPQSSNVSARMCVIGAGKMGKLVIKHLMAK
GCTKVVVVNRSEERVSAIREEMPGIEIIYRPLDEMLACASEADVVFTSTASETPLFLKEH
VENLPQASPEVGGLRHFVDISVPRNVGSCVGEVETARVYNVDDLKEVVAANKEDRMRKAM
EAQTIITEESTQFEAWRDSLETVPTIKKLRAYAERIRVAELEKCMSKMGDDINKKTTRAV
DDLSRGIVNRFLHGPMQHLRCDGSDSRTLSETLENMHALNRMYGLEKDILEEKLKAMAEQ
QQK

www.000webhost.com

Other information
Ka divergence:-0.104735KaKs divergence:-0.32922
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):1593Length 2 (bp):1632Length divergence:0.012
MFE 1 (kcal):-498.1MFE 2 (kcal):-510.3MFE divergence0.012