Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G09980-AT1G58350
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Putative serine esterase family protein
Function (paralog2):Putative serine esterase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.41820104473553
Log2 mRNA fold difference:0.2979641870341
Log2 TE fold difference:0.077516758786594
Sequences
Protein sequence

MLRRLGWLIGLSQRSRQTKSIDAEPYVARVKPVLMIDTVQEIAIYIHRFHNLDLFQQGWY
QIKISMRWEDGDNNSCGIPSRVVQYEALDSTSNDSYGVWKIDDKDSSFLTQPFRIKYARQ
DVRLCMMVSFTMPLERYEGSATSAVILKFELLYSPIMEDIPVTHSDACAAAVHEFRIPPK
ALSGVHSYCPVHFDTFHAVLIDVSVHVSVMKSAAYKRPAILSSDASNGKNLTSGNIQSSK
KAFTQIASADKKLVSFVKALLGARDTLLEEMQRLSKAVGQTVDLSEFVSSMDNALLSDSG
STGKSVEVEGSGQGKLQNNLEKLNGPFDLASDDWLHNFSKEHLSRTFHLLGTQLHYLWNT
FLTLHRDNYTKILEYLRDIWTKDRRAEWSIWMVYSKVEMPHHFISGMEDISNHSSHKRVS
TGLKLNDPAQVASTRAELHRRSIAQMRINNRAIQDMHIFGDPMRVPIVIIERVWNAPRRT
FSDNSYMRHVDRIDSSLLNGHDDESGTKKHINPQHTGRELKIVVFVHGFQGHHLDLRLIR
NQWLLIDPKIEFLMSEANEERTHGDFREMGQRLAQEVVSFFKRKKDKHARYGRLKNIKLS
FVGHSIGNVIIRAAIADSLMDPYRKYFHTYISLSGPHLGYLYSSNSLFNSGLWLLKKLKS
TQVIHQLTLTDDPDLQNTFFYKLCKQKTLCSFKNIILLSSPQDGYVPYHSARIESCQPAS
FDNSKRGVAFLEMLNNCMDQIRGPSPETPHHQRVFMRCDVNFDTTLYGRNLNSFIGRAAH
IEFLESDVFARFIMWSFQDLFR

MLHRLRWFIGLSKRSREAKTLDAKPYISKVKPVLMVDTVQEIAIYIHRFHNLDLFQQGWY
QIKITMRWEDGDNVTRGIPSRVVQYEAPDSGANDSYGVWKIVDKDNSFLTQPFRIKYARQ
DIRLCMMISFTLPLERYEGSATSAAILKFELMYAPSVDNASAKQLDTSPVAVHEFRIPPK
ALTGLHSYCPVHFDTLHAVLIDVSVHISVLKSAAYKRPASLSSGVSNSKNVSGSSAQSFK
KALGLLASADKKLVSFVKALLGARGILLEEMQRLSKAVGQTIDLSDFVSNMNNVQLSNST
STGSGQGKEQNSLENLNITFDLTSDDWLHELSKDHLSRIFHLLGTQLHYLWNTLLGFHRD
NHTKILEYLRDIWTKDRRAEWSIWMVYSKVEMPHHFINSGMTDILNQSAHKRASGVLNEP
AQIAATRAELHRRSIAQMRINNRSIQDMHILGDPMRVPIVIIERVLNAPRRTLSDNSYLR
HMDLLDSSLLNGHKDEAEKTKVTNSQQSARELKIVVFVHGFQGHHLDLRLVRNQWLLIDP
KIEFLMSEANEEKTHGDFREMGQRLAQEVVSFLKRKKDRYARQGHLKSIKLSFVGHSIGN
VIIRTAIADSLMEPYRKYLHTYLSLSGPHLGYLYSTNSLFNSGLWLLKKLKSTQVIHQLT
LTDDPDLRHTFFYKLCKQKTLENFKNIILLSSPQDGYVPYHSARIESCQPASFDSSKRGV
AFLEMLNNCLDQIRGPVPEAPHQQRVFMRCDVNFDMTVYGRNLNSFIGRAAHIEFLESDI
FARFIMWSFQDLFR

www.000webhost.com

Other information
Ka divergence:0.0293779KaKs divergence:0.290378
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):2409Length 2 (bp):2385Length divergence:-0.005
MFE 1 (kcal):-722.45MFE 2 (kcal):-695.53MFE divergence-0.019