Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10140-AT1G58420
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Uncharacterised conserved protein UCP031279
Function (paralog2):Uncharacterised conserved protein UCP031279

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.5098348361161
Log2 mRNA fold difference:-1.5703111080471
Log2 TE fold difference:-0.084827198742118
Sequences
Protein sequence

MKQNQSKFLRIISTPLRALGKARDFYVRSITGCAARTQYSSSASVSAPFPRSRSSSSAAF
SSSASSRRTTDFGIDEDYSELVRAASVRSLGHKNEIDMLIQEKLQQQKQQKQGGLPKSSS
AGMARIEEEEETEEGSVNPKVKKTKKVSDLLYPRSKSYAVTTSTPIL

MGKRGQKQNRFLRIVTMPLKVLCKARDLYMRSITGCAARTHYSSAVDAASVPFPRSRSTS
SAFSSSASSRRRSSDFTFDDDYSELLRAASVRSLGHKNEIDMIIQQQQQQQQQRQENRVA
MGAVTVKGGLPKSSSVGMTMARIDEEDEEEGSVKNQKKGSDFLYPRSRSHAVTIRGSKF

www.000webhost.com

Other information
Ka divergence:0.0548325KaKs divergence:-0.229682
GC content 1 (%):49GC content 2 (%):46GC content divergence:-0.032
Length 1 (bp):504Length 2 (bp):540Length divergence:0.034
MFE 1 (kcal):-157.1MFE 2 (kcal):-167.15MFE divergence0.031