Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10150-AT1G59510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Carbohydrate-binding protein
Function (paralog2):Carbohydrate-binding protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-3.5400476117117
Log2 mRNA fold difference:-3.9962786130084
Log2 TE fold difference:0.49937311142918
Sequences
Protein sequence

MDLLRLREKGIFLSQRRRKWLIFMAISGVSGYGAYKVYHLPSVARKRKRLFKLFGAIVSV
AELISDSAETLSMVSRDVKDFLNSDSDEIPNSLKQIAKITTSNEFTDSLSRVSQAVTIGA
FRGYKSESSIGDSGIEKSSDSSVVDRVIDKVFSEAGTGFVSVVVGSFAKNLVLGFYSGKV
ESGVKCEGSDSSETPRWVTLLGDDKCRELLADCIERFTSTAIGVYLDKTMDINTYDQIFE
GLTNPKHQDSVKDVLVSVCNGALETIVRTSHDVFTSSRSKNVIEEIEDDDFKSNGSARSK
MVSESGDGVKSNGWTEAIATTLAVPSNRRFMFDVTGRVTLETTRSIIAFIMVKTFQGFRK
SINVVHEEVTDRGRQAVEYVGAKSSVIITVCLALYLHIISGCVRNSPIGVSQHF

MDLVRLRDIGSISPQRRRKWLILLAVFGVSGYGVYRVYNSQYIAKKTKRLMKLFSGIVSF
AEMVIDSAETISIVSRDLKEFLESNSHEIPNSLKQLSKITKSKEFTDSLARVSEAVAIGV
FRGYNSDPNVEKESNLSVVDRVFSEEGAGFVSVVVGSFAKNLVLGFYSGEIEIGSDDSLK
PRWMNLLSDDKCRELLADCIERFTSSAVSVYIDKTVGVNTYDQIFAGLTNPKHRDSARDV
LVSVCNGALETFMRTSHDVFTSSGEKTDSSLRKSENRENGWAEALSTTLAVPSNRKFMFD
VTGRVTLETMRSILEFVILKTSQSFKRSLDVIHEEVTERGRQVVGYVGAKSSVIITVCLA
VYFHIFNRFVRGPPVCLSQQF

www.000webhost.com

Other information
Ka divergence:0.152566KaKs divergence:-0.269043
GC content 1 (%):41GC content 2 (%):40GC content divergence:-0.012
Length 1 (bp):1245Length 2 (bp):1146Length divergence:-0.041
MFE 1 (kcal):-381.3MFE 2 (kcal):-336.16MFE divergence-0.063