Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10210-AT1G59580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):mitogen-activated protein kinase 1
Function (paralog2):mitogen-activated protein kinase homolog 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.2110210175929
Log2 mRNA fold difference:2.1362149036759
Log2 TE fold difference:0.18501651260646
Sequences
Protein sequence

MATLVDPPNGIRNEGKHYFSMWQTLFEIDTKYMPIKPIGRGAYGVVCSSVNSDTNEKVAI
KKIHNVYENRIDALRTLRELKLLRHLRHENVIALKDVMMPIHKMSFKDVYLVYELMDTDL
HQIIKSSQVLSNDHCQYFLFQLLRGLKYIHSANILHRDLKPGNLLVNANCDLKICDFGLA
RASNTKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFQGTECL
NQLKLIVNILGSQREEDLEFIDNPKAKRYIRSLPYSPGMSLSRLYPGAHVLAIDLLQKML
VFDPSKRISVSEALQHPYMAPLYDPNANPPAQVPIDLDVDEDLREEMIREMMWNEMLHYH
PQASTLNTEL

MATPVDPPNGIRNQGKHYFSMWQTLFEIDTKYVPIKPIGRGAYGVVCSSVNRESNERVAI
KKIHNVFENRIDALRTLRELKLLRHLRHENVVALKDVMMANHKRSFKDVYLVYELMDTDL
HQIIKSSQVLSNDHCQYFLFQLLRGLKYIHSANILHRDLKPGNLLVNANCDLKICDFGLA
RTSNTKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPVFPGTECL
NQIKLIINILGSQREEDLEFIDNPKAKRYIESLPYSPGISFSRLYPGANVLAIDLLQKML
VLDPSKRISVTEALQHPYMAPLYDPSANPPAQVPIDLDVDEDEDLGAEMIRELMWKEMIH
YHPEAATINNNEVSEF

www.000webhost.com

Other information
Ka divergence:0.0460585KaKs divergence:0.101449
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1113Length 2 (bp):1131Length divergence:0.008
MFE 1 (kcal):-319.64MFE 2 (kcal):-324.58MFE divergence0.008