Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10290-AT1G59610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):dynamin-like protein 6
Function (paralog2):dynamin-like 3

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.20080217892135
Log2 mRNA fold difference:-0.27690725823894
Log2 TE fold difference:0.053197038610338
Sequences
Protein sequence

MEAIDELSQLSDSMKQAASLLADEDPDETSSSKRPATFLNVVALGNVGAGKSAVLNSLIG
HPVLPTGENGATRAPIIIELSRESSLSSKAIILQIDNKSQQVSASALRHSLQDRLSKGAS
GKNRDEINLKLRTSTAPPLKLVDLPGLDQRIVDESMIAEYAQHNDAILLVIVPASQASEI
SSSRALKIAKEYDPESTRTIGIIGKIDQAAENSKALAAVQALLSNQGPPKTTDIPWVAVI
GQSVSIASAQSGSGENSLETAWRAESESLKSILTGAPQSKLGRIALVDTLASQIRSRMKL
RLPSVLSGLQGKSQIVQDELARLGEQLVNSAEGTRAIALELCREFEDKFLLHLAGGEGSG
WKVVASFEGNFPNRIKQLPLDRHFDLNNVKRVVLEADGYQPYLISPEKGLRSLIKIVLEL
AKDPARLCVDEVHRVLVDIVSASANATPGLGRYPPFKREVVAIASAALDGFKNEAKKMVV
ALVDMERAFVPPQHFIRLVQRRMERQRREEELKGRSSKKGQDAEQSLLSRATSPQPDGPT
AGGSLKSMKDKPSPQDKETPEVSGLKTAGPEGEITAGYLMKKSAKTNGWSRRWFVLNEKT
GKLGYTKKQEERNFRGTITLEECTIEEIPEDEVEKSKSSKDKKANGPDSKGPGLVFKITC
KVPYKTVLKAHNALVLKAESVVDKNEWINKLQKVIQARGGQVGSVSMRQSLSEGSLDKMV
RKPIDPEEELRWMSQEVRGYVEAVLNSLAANVPKAVVLCQVEKAKEDMLNQLYSSISAIG
NERIESLIQEDQNVKRRRERYQKQSSLLSKLTRQLSIHDNRAAAASSYSDNSGTESSPRA
SGGSSGDDWMNAFNSAANGPSDSLSKYGSGGHSRRYSDPAQNGDAASPGSGSNRRTTPNR
LPPAPPPTGSAYRY

MEAIDELSQLSDSMRQAASLLADEDPDETSSSRRPATSLNVVALGNVGAGKSAVLNSLIG
HPVLPTGENGATRAPIIIDLSREESLSSKAIILQIDNKNQQVSASALRHSLQDRLSKGAS
GRGRDEIYLKLRTSTAPPLKLIDLPGLDQRIVDDSMIGEHAQHNDAILLVVVPASQASEI
SSSRALKIAKEYDPESTRTVGIISKIDQAAENPKSLAAVQALLSNQGPPKTTDIPWVALI
GQSVSIASAQSGGSENSLETAWRAESESLKSILTGAPQSKLGRIALVDTLASQIRSRMKL
RLPNILTGLQGKSQIVQDELARLGEQLVSSAEGTRAIALELCREFEDKFLLHLAGGEGSG
WKVVASFEGNFPNRIKKLPLDRHFDLNNVKRIVLEADGYQPYLISPEKGLRSLIKTVLEL
AKDPARLCVDEVHRVLVDIVSASANATPGLGRYPPFKREVVAIASAALDGFKNEAKKMVV
ALVDMERAFVPPQHFIRLVQRRMERQRREEELKGRSSKKGQDAEQSLLNRATSPQPDGPS
STGGSLKSLRDKLMPQDKDKDKEKETPEVSGLKTAGPEGEITAGYLMKKSAKTNGWSRRW
FVLNEKTGKLGYTKKQEERNFRGTVTLEECSIEEISDDEGEKSKSSKDKKSNGPDSKGPG
LVFKITCRVPYKTVLKAHNALVLKAESMVDKNEWINKLQKVIQARGGQVGSASMRQSLSE
GSLDKMVRKPVDPEEELRWMSQEVRGYVEAVLNSLAANVPKAVVLCQVEKSKEDMLNQLY
SSISAIGNERIESLIQEDQNVKRRRDRYQKQSSLLSKLTRQLSIHDNRAAAASSWSDNSG
TESSPRTNGGSSGEDWMNAFNAAASGPDSLKRYGSGGHSRRYSDPAQNGEDSSGSGGSSR
RTTPNRLPPAPPQSGSSYRY

Other information
Ka divergence:0.0407809KaKs divergence:-0.00557103
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):2745Length 2 (bp):2763Length divergence:0.003
MFE 1 (kcal):-901.32MFE 2 (kcal):-880.52MFE divergence-0.012