Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10350-AT1G59725
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DNAJ heat shock family protein
Function (paralog2):DNAJ heat shock family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-3.6059080420901
Log2 mRNA fold difference:-4.0242713993102
Log2 TE fold difference:0.95792468697483
Sequences
Protein sequence

MGVDYYNVLKVNRNANEDDLKKSYRRMAMKWHPDKNPTSKKEAEAKFKQISEAYDVLSDP
QRRQIYDQYGEEGLKSTDLPTAAETAAHQQQRSYSSSNSEFRYYPRDAEDIFAEFFGESG
DAFGGGSSGRTRGDGGDGGGRRFKSAEAGSQANRKTPPTNKKTTPPANRKAPAIESKLAC
TLEELYKGAKKKMRISRVVPDDFGKPKTVQEILKIDIKPGWKKGTKITFPEKGNQEPGVT
PADLIFVVDEKPHSVFKRDGNDLILEKKVSLIDALTGLTISVTTLDGRSLTIPVLDIVKP
GQEIVIPNEGMPTKDPLKRGDLRVTFEILFPSRLTSEQKNDLKRVLGGS

MGVDYYNVLNVNPSATEDDLKKSYRRLAMKWHPDKNPTSIKQEAEAKFKQISEAYDVLSD
PNKRQIYDQYGEDGLTATEATASSQQHNYSSGNNNNYNAGFRYYPRDAEDIFAEFFGASE
KVFDGGVGGGGRFKSAEAGSQTNRKTPVNRKAPAIESKLACTLEELYKGGRRKMKISRVV
PDGLGKSKPVEEILKIDITPGWKKGTKITFPEKGNQEPGVTPADLIFVIDEKPHSVYKRD
GNDLIVDKKVSLLEALTGITLSLTTLDGRNLTIPVLDIVKPGQEIVIPSEGMPISKEGSK
RGDLRINFEICFPSRLTSEQKTDLKRVLGGS

Other information
Ka divergence:0.236491KaKs divergence:-0.99988
GC content 1 (%):47GC content 2 (%):43GC content divergence:-0.044
Length 1 (bp):1050Length 2 (bp):996Length divergence:-0.026
MFE 1 (kcal):-321.7MFE 2 (kcal):-274.25MFE divergence-0.08