Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10360-AT1G10370
Species:Arabidopsis
Duplication type:TD
Function (paralog1):glutathione S-transferase TAU 18
Function (paralog2):Glutathione S-transferase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.32594539825726
Log2 mRNA fold difference:-1.3413488203554
Log2 TE fold difference:1.056250108417
Sequences
Protein sequence

MATEDVKLIGSWASVYVMRARIALHLKSISYEFLQETYGSKSELLLKSNPVHKKMPVLIH
ADKPVCESNIIVHYIDEAWNSSGPSILPSHPYDRAIARFWAAYIDDQWFISVRSILTAQG
DEEKKAAIAQVEERTKLLEKAFNDCSQGKPFFNGDHIGYLDIALGSFLGWWRVVELDANH
KFLDETKTPSLVKWAERFCDDPAVKPIMPEITKLAEFARKLFPKRQA

MASSDVKLIGAWASPFVMRPRIALNLKSVPYEFLQETFGSKSELLLKSNPVHKKIPVLLH
ADKPVSESNIIVEYIDDTWSSSGPSILPSDPYDRAMARFWAAYIDEKWFVALRGFLKAGG
EEEKKAVIAQLEEGNAFLEKAFIDCSKGKPFFNGDNIGYLDIALGCFLAWLRVTELAVSY
KILDEAKTPSLSKWAENFCNDPAVKPVMPETAKLAEFAKKIFPKPQA

www.000webhost.com

Other information
Ka divergence:-0.463251KaKs divergence:0.166692
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):684Length 2 (bp):684Length divergence:0
MFE 1 (kcal):-213.1MFE 2 (kcal):-220.9MFE divergence0.018