Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10390-AT1G59660
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Nucleoporin autopeptidase
Function (paralog2):Nucleoporin autopeptidase

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-3.1950825616586
Log2 mRNA fold difference:-3.4211469759557
Log2 TE fold difference:0.22973249533765
Sequences
Protein sequence

MFGSSNPFGQSSGTSPFGSQSLFGQTSNTSSNNPFAPATPFGTSAPFAAQSGSSIFGSTS
TGVFGAPQTSSPFASTPTFGASSSPAFGNSTPAFGASPASSPFGGSSGFGQKPLGFSTPQ
SNPFGNSTQQSQPAFGNTSFGSSTPFGATNTPAFGAPSTPSFGATSTPSFGASSTPAFGA
TNTPAFGASNSPSFGATNTPAFGASPTPAFGSTGTTFGNTGFGSGGAFGASNTPAFGASG
TPAFGASGTPAFGASSTPAFGASSTPAFGASSTPAFGGSSTPSFGASNTSSFSFGSSPAF
GQSTSAFGSSAFGSTPSPFGGAQASTPTFGGSGFGQSTFGGQQGGSRAVPYAPTVEADTG
TGTQPAGKLESISAMPAYKEKNYEELRWEDYQRGDKGGPLPAGQSPGNAGFGISPSQPNP
FSPSPAFGQTSANPTNPFSSSTSTNPFAPQTPTIASSSFGTATSNFGSSPFGVTSSSNLF
GSGSSTTTSVFGSSSAFGTTTPSPLFGSSSTPGFGSSSSIFGSAPGQGATPAFGNSQPST
LFNSTPSTGQTGSAFGQTGSAFGQFGQSSAPAFGQNSIFNKPSTGFGNMFSSSSTLTTSS
SSPFGQTMPAGVTPFQSAQPGQASNGFGFNNFGQNQAANTTGNAGGLGIFGQGNFGQSPA
PLNSVVLQPVAVTNPFGTLPAMPQISINQGGNSPSIQYGISSMPVVDKPAPVRISSLLTS
RHLLHRRVRLPARKYRPGENGPKVPFFTDDEESSSTPKADALFIPRENPRALVIRPVQQW
SSRDKSILPKEQRPTAPLHDNGKSPDMATDAANHDRNGNGELGATGERIHTSVNANQKPN
GTTRSDQASEKERPYKTLSGHRAGEAAIVYEHGADIEALMPKLRQSDYFTEPRIQELAAK
ERADPGYCRRVRDFVVGRHGYGSIKFMGETDVRRLDLESLVQFNTREVIVYMDESKKPAV
GQGLNKPAEVTLLNIKCIDKKTGKQFTEGERVEKYKMMLKKKAEAQGAEFVSFDPVKGEW
KFRVEHFSSYKLGDEDEEDGV

MFGSSNNNPFGQSSISSPFGTQTHSLFGQTNNNASNNPFATKPFGTSTPFGAQTGSSMFG
GTSTGVFGAPQTSSPFGASPQAFGSSTQAFGASSTPSFGSSNSPFGGTSTFGQKSFGLST
PQSSPFGSTTQQSQPAFGNSTFGSSTPFGASTTPAFGASSTPAFGVSNTSGFGATNTPGF
GATNTTGFGGSSTPGFGASSTPAFGSTNTPAFGASSTPLFGSSSSPAFGASPAPAFGSSG
NAFGNNTFSSGGAFGSSSTPTFGASNTSAFGASSSPSFNFGSSPAFGQSTSAFGSSSFGS
TQSSLGSTPSPFGAQGAQASTSTFGGQSTIGGQQGGSRVIPYAPTTDTASGTESKSERLQ
SISAMPAHKGKNMEELRWEDYQRGDKGGQRSTGQSPEGAGFGVTNSQPSIFSTSPAFSQT
PVNPTNPFSQTTPTSNTNFSPSFSQPTTPSFGQPTTPSFRSTVSNTTSVFGSSSSLTTNT
SQPLGSSIFGSTPAHGSTPGFSIGGFNNSQSSPLFGSNPSFAQNTTPAFSQTSPLFGQNT
TPALGQSSSVFGQNTNPALVQSNTFSTPSTGFGNTFSSSSSLTTSISPFGQITPAVTPFQ
SAQPTQPLGAFGFNNFGQTQIANTTDIAGAMGTFSQGNFKQQPALGNSAVMQPTPVTNPF
GTLPALPQISIAQGGNSPSIQYGISSMPVVDKPAPVRVSPLLTSRHLLQRRVRLPTRKYR
PSDDGPKVPFFSDEEENSSTPKADAFFIPRENPRALFIRPVERVKSEHPKDSPTPLQENG
KRSNGVTNGANHETKDNGAIREAPPVKVNQKQNGTHENHGGDKNGSHSSPSGADIESLMP
KLHHSEYFTEPRIQELAAKERVEQGYCKRVKDFVVGRHGYGSIKFLGETDVCRLDLEMVV
QFKNREVNVYMDESKKPPVGQGLNKPAVVTLLNIKCMDKKTGTQVMEGERLDKYKEMLKR
KAGEQGAQFVSYDPVNGEWTFKVEHFSSYKLGDEYDV

www.000webhost.com

Other information
Ka divergence:0.319974KaKs divergence:0.000578815
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):3126Length 2 (bp):2994Length divergence:-0.022
MFE 1 (kcal):-988.17MFE 2 (kcal):-885.77MFE divergence-0.055