Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10410-AT1G59650
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF1336)
Function (paralog2):Protein of unknown function (DUF1336)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.9475665790913
Log2 mRNA fold difference:-0.90560344750285
Log2 TE fold difference:-1.0418895226214
Sequences
Protein sequence

MGGCVSTPKSCVGAKLRSSKRRKSRRRRKIQRKRAAVSSRLSDGSFDNLDHHHRNFSNPS
SRATGEDAWFESNVAFETDCDDDFHSVHEDALSLNGSERVSLSSTTTTSSTRDTDSNEVM
SQSKSDGDLNDTNQPDLIDSSADEGLLENCRILPSNCLPCLNTTTVPSIDKRRSLSSSPP
SSRKKSSLRLSYKWREGHASGALFLSKMQLKRPIAGSQVPFCPIDKKMLDCWSTIDPNSF
RVRGKTYLREKKKEFAPSHAAYNPFGVDVFLSEHKIHHVAQYVKLPVTTTSTKLPSILVV
NVQIPLYPTAIFQGESDGEGMNIVLYFKLSDNYSKELPLHFQESIRRLIDDEVEKVKGFP
LDTTAPFRERLKILGRVANVDDLHLSGPEKKLMQAYNEKPVLSRPQHEFYLGDNYFEIDI
DMHRFGYISRKGFETFIDRLKICVLDVGLTIQGNKPEELPEQILCCVRLNGIDFMNYHQL
TQELL

MGGCVSTPKSCVGGKIRSSKRRKTRTRRKIQKKRVVSSSRLSDGSFDNNPTFRASVDEAW
FDSNLAFETDCDDDFHSVQEDTLSVNGCERISVSSMSSVKDSNLGGSARNSLSDVISQSK
SESALIDTKQAVFIDEISSNADGSSNKDEGLLENCGILPSNCLPCLNSTVPSIEKRRSLS
SSPPSTRKKAAVKLSFKWREGHPTGPLFSTTMQLQRPMAGSQVPFCPLEKKMFDSWSIIE
PGSFRVRSKTYFRDKKKELAPNYAAYNPFGVDVFLSQRKVNHIAQYVELPVVTTTPTKLP
SILVVNVQIPLYPAAIFHGETDGEGMNFVLYFKLSDNYLKELPPHFQESIQRLLDDEVEK
VRGYTTDTNVPFRERLKILGRVANVDDLQLNGAEKKLMNAYNEKPVLSRPQHEFYSGENY
FEIDIDMHRFSYISRKGFEAFLDRLKNCVLDVGLTIQGNKPEELPEQILCCIRLNGIDYM
NYHQLALSQEVL

Other information
Ka divergence:-0.23453KaKs divergence:0.297172
GC content 1 (%):42GC content 2 (%):40GC content divergence:-0.024
Length 1 (bp):1458Length 2 (bp):1479Length divergence:0.007
MFE 1 (kcal):-416.04MFE 2 (kcal):-413.2MFE divergence-0.003