Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10430-AT1G59830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):protein phosphatase 2A-2
Function (paralog2):protein phosphatase 2A-2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.072691426006985
Log2 mRNA fold difference:0.42867817106752
Log2 TE fold difference:-0.34555515082287
Sequences
Protein sequence

MPSNGDLDRQIEQLMECKPLSEADVRTLCDQARAILVEEYNVQPVKCPVTVCGDIHGQFY
DLIELFRIGGNAPDTNYLFMGDYVDRGYYSVETVSLLVALKVRYRDRLTILRGNHESRQI
TQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRSL
DRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIAAQFNHNNGLSLISRAHQL
VMEGFNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMEQNFLQFDPAPRQVEPDTTRK
TPDYFL

MPLNGDLDRQIEQLMECKPLGEADVKILCDQAKAILVEEYNVQPVKCPVTVCGDIHGQFY
DLIELFRIGGNAPDTNYLFMGDYVDRGYYSVETVSLLVALKVRYRDRLTILRGNHESRQI
TQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRSL
DRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIATQFNHNNGLSLISRAHQL
VMEGYNWCQEKNVVTVFSAPNYCYRCGNMAAILEIGEKMEQNFLQFDPAPRQVEPDTTRK
TPDYFL

Other information
Ka divergence:0.337641KaKs divergence:0.74
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):921Length 2 (bp):921Length divergence:0
MFE 1 (kcal):-297.58MFE 2 (kcal):-283.33MFE divergence-0.025