Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10470-AT1G59940
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):response regulator 4
Function (paralog2):response regulator 3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-3.5295607832245
Log2 mRNA fold difference:-3.0658419168172
Log2 TE fold difference:-0.54436930780867
Sequences
Protein sequence

MARDGGVSCLRRSEMMSVGGIGGIESAPLDLDEVHVLAVDDSLVDRIVIERLLRITSCKV
TAVDSGWRALEFLGLDNEKASAEFDRLKVDLIITDYCMPGMTGYELLKKIKESSNFREVP
VVIMSSENVLTRIDRCLEEGAQDFLLKPVKLADVKRLRSHLTKDVKLSNGNKRKLPEDSS
SVNSSLPPPSPPLTISPESSPPLTVSTESSDSSPPLSPVEIFSTSPLSSPIDDEDDDVLT
SSSEESPIRRQKMRSPGLD

MAKDGGVSCLRRSEMIGIGIGELESPPLDSDQVHVLAVDDSLVDRIVIERLLRITSCKVT
AVDSGWRALEFLGLDDDKAAVEFDRLKVDLIITDYCMPGMTGYELLKKIKESTSFKEVPV
VIMSSENVMTRIDRCLEEGAEDFLLKPVKLADVKRLRSYLTRDVKVAAEGNKRKLTTPPP
PPPLSATSSMESSDSTVESPLSMVDDEDSLTMSPESATSLVDSPMRSPGLA

www.000webhost.com

Other information
Ka divergence:0.471292KaKs divergence:0.343011
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):780Length 2 (bp):696Length divergence:-0.057
MFE 1 (kcal):-256.9MFE 2 (kcal):-225.4MFE divergence-0.065