Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10530-AT1G60010
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:6.0623484066926
Log2 mRNA fold difference:5.6381889257794
Log2 TE fold difference:0.36402990440814
Sequences
Protein sequence

MGNCQAVNAAVLVLQHPGGIIDRYYSSVSVTEVMAMYPGHYVSLIIPLSEEEEKNIPATE
KGDDKKQRKAVRFTRVQLLRPTENLVLGHAYRLITSQEVMKVLREKKSAKTKKHQIEKTT
TAKKFSDKKVPEKKQGKQFRVIRNSTSLLKSKTWRPSLQSISEATS

MGNCQAVDAAALVLQHPDGKIDRYYGPVSVSEIMRMYPGHYVSLIIPLPEKNIPATTTTT
DDKSERKVVRFTRVKLLRPTENLVLGHAYRLITSQEVMKVLRAKKYAKTKKHQSETSKEK
KKPSSEKKIDEESDKNQNLETKDEKQRSVLTNSASSRSKTWRPSLQSISEATS

www.000webhost.com

Other information
Ka divergence:-0.267256KaKs divergence:-0.000835422
GC content 1 (%):48GC content 2 (%):43GC content divergence:-0.055
Length 1 (bp):501Length 2 (bp):522Length divergence:0.021
MFE 1 (kcal):-155.4MFE 2 (kcal):-146.4MFE divergence-0.03