Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10560-AT1G60190
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):plant U-box 18
Function (paralog2):ARM repeat superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.7685819801541
Log2 mRNA fold difference:1.1207521594606
Log2 TE fold difference:0.51990700583996
Sequences
Protein sequence

MIHTKTGSGRRILTFPTVEPSESISIVTLLDSLIQLAGDILTFKSKHFSTNKQSFRETLR
RIQNLLVVFEEIRIRIRNSRRYFHDSAAASSLKEIHVGFQKLKFLLEDCTRDGARLCMMM
NSDQVSDHLRVLTRSISTSLSAFPVASVDLTTEVNELIDLVVRQARKYGVQPETNDKRAV
SSINRILALFVNRVVPDPDEINRILDHVGIRKWGDCVKEINFLGEEIDAERLDEKKKKSS
DQVELLSSLMGFICYCRCIILGRIERDDHHNHHEDGIKKDHDLIRGLKVEDLLCPISLEI
MTDPVVIETGHTYDRSSITKWFGSGNITCPITGKILTSTELVDNVSVRQVIRKHCKTNGI
VLAGISRRRKSHDDVVPESLAAKGAGKLIAKFLTSELINGGEEMIYRAVREIRVQTKTSS
FNRSCLVKAGAVTPLLKLLSSVDIRIQENAMAGILNLSKHVTGKSKIAGEGLKILVEILN
EGAKTETRLYSASALFYLSSVEDYSRLIGENPDAIPGLMNIVKGDDYGDSAKRSALLAVM
GLLMQSDNHWRVLAAGAVPILLDLLRSGEISGGLTADCLATLAKLAEYPDGTIGVIRRGG
LKLAVKILSSSEDSPVAVKQHCVGLILNLCLNGGRDVVGVLVKNSLVMGSLYTVLSNGEY
GGSKKASALIRMIHEFQERKTGSVEPNLQRGRFVHAW

MIHTPTGSSRRILTFPAVNPCESISLTTLVDSLLQLAGEILSFKPKHFSTNKRSVKETLR
HVQTLVIFFEELRIQIRVGSIPAGRSVILSLSELHVIFQKLKFLLDDCTRDGAKLYMLMN
SGQVSAHFRDLTRSISTSLDTFPVRSVDLPGEVNELIYLVMRQTRKSEARPDRDDKRAID
SVYWFFNLFENRINPNSDEILRVLDHIGVRKWRDCVKEIDFLREEISVGKKSNIEIELLS
NLMGFICYCRCVILRGIDVDDEEKDKEEDDLMMVRSLNVDDLRCPISLEIMSDPVVLESG
HTYDRSSITKWFASGNITCPKTGKTLVSTVLVDNFSVKQVIQSYSKQNGVVMGQKGKKKV
DVAESLAAEEAGKLTAEFLAGELIKGDEEEMVKALVEIRILTKTSTFYRSCLVEAGVVES
LMKILRSDDPRIQENAMAGIMNLSKDIAGKTRIVGEDGGGLRLIVEVLNDGARRESRQYA
AAALFYLSSLGDYSRLIGEISDAIPGLVRIVKSCDYGDSAKRNALIAIRSLLMNQPDNHW
RILAAGIVPVLLDLVKSEEISDGVTADSMAILAKMAEYPDGMISVLRRGGLKLAVKILGS
SEVSPATKQHCVALLLNLCHNGGSDVVGSLAKNPSIMGSLYTASSNGELGGGKKASALIK
MIHEFQERKTGPGEPVLERERFVHAW

www.000webhost.com

Other information
Ka divergence:-0.0469518KaKs divergence:-0.113033
GC content 1 (%):47GC content 2 (%):45GC content divergence:-0.022
Length 1 (bp):2094Length 2 (bp):2061Length divergence:-0.008
MFE 1 (kcal):-712.62MFE 2 (kcal):-692.25MFE divergence-0.014