Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10570-AT1G60220
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Cysteine proteinases superfamily protein
Function (paralog2):UB-like protease 1D

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.047127804132449
Log2 mRNA fold difference:0.30477826034443
Log2 TE fold difference:-0.22686268445314
Sequences
Protein sequence

MKRQRAIELDRVKKTMLNIDWDDALGDEEVPELEIIATDKIPPREPTLSGYEPAVSVRSL
RDNELDDHLKRQRSLLTRLGDKLADKGEKIRNRIGELEYEKQRRMFQQRTKMQDADNGCQ
ILEKPKSSDVFMRASTASKDTSGQGTSGSKDVSRSTFAAHFSDNLKMGPQPVKLVNDKLQ
DLGRGSWISKANRDSIIEKNNVWRSLPRLSKCKVSLKNFYSESKDPKGDRRPNEAYGKGK
PNESSPYLLVDDDDGDDDKVIGYETPRHWSLKASPLQSSSCRKKSDDKVINLDEDEPLSP
MVVEEACELPEGLPEDIYYPSSDQSDGRDLVQVSLKDLKCLSPGEYLTSPVINFYIRYVQ
HHVFSADKTAANCHFFNTFFYKKLTEAVSYKGNDRDAYFVKFRRWWKGFDLFCKSYIFIP
IHEDLHWSLVIICIPDKEDESGLTIIHLDSLGLHPRNLIFNNVKRFLREEWNYLNQDAPL
DLPISAKVWRDLPNMINEAEVQVPQQKNDFDCGLFLLFFIRRFIEEAPQRLTLQDLKMIH
KKWFKPEEASALRIKIWNILVDLFRKGNQTD

MTKRKKEVIDVDCSEKKDFVIDWSSAMDKEDEVPELEIVNTTKPTPPPPPTFFSDDQTDS
PKLLTDRDLDEQLERKKAILTLGPGLPDKGEKIRLKIADLEEEKQRRVLEGSKMEVDRSS
KVVSSTSSGSDVLPQGNAVSKDTSRGNADSKDTSRQGNADSKEVSRSTFSAVFSKPKTDS
QSKKAFGKELEDLGCERRKHKAGRKPVTRLSNGWRLLPDVGKAEHSAKQFDSGLKESKGN
KKSKEPYGKKRPMESSTYSLIDDDDDDDDDDDNDTSGHETPREWSWEKSPSQSSRRRKKS
EDTVINVDEEEAQPSTVAEQAAELPEGLQEDICYPTRDDPHFVQVCLKDLECLAPREYLT
SPVMNFYMRFLQQQISSSNQISADCHFFNTYFYKKLSDAVTYKGNDKDAFFVRFRRWWKG
IDLFRKAYIFIPIHEDLHWSLVIVCIPDKKDESGLTILHLDSLGLHSRKSIVENVKRFLK
DEWNYLNQDDYSLDLPISEKVWKNLPRRISEAVVQVPQQKNDFDCGPFVLFFIKRFIEEA
PQRLKRKDLGMFDKKWFRPDEASALRIKIRNTLIELFRVSDQTE

Other information
Ka divergence:-0.194498KaKs divergence:-0.601321
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1716Length 2 (bp):1755Length divergence:0.011
MFE 1 (kcal):-477.52MFE 2 (kcal):-514.66MFE divergence0.037