Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10640-AT1G60590
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Pectin lyase-like superfamily protein
Function (paralog2):Pectin lyase-like superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.14744063051678
Log2 mRNA fold difference:-0.7011639666035
Log2 TE fold difference:0.48138657273107
Sequences
Protein sequence

MIMRRSLSLRSITMMILMAVLVWSVTLETCIARRGRHWRHSHRSSSDLSDSLSNKKPKSH
GNSHHHSSHNNNHHHKSKPKPKPKLKTPPKAHDNNSPVVSGPPKVQPPPLPPQKGSQVFN
VMDFGAKGDGKCDDTKAFEAAWVAACKIEASVMLVPPEYTYLVGPISFSGPYCQANIVFQ
LDGTIIAPTDSKTWGKGLMWWIDFTKLKGIKVQGKGVIDGRGSGWWQQDSPFIDSDTKLI
VPLNNSANQNPPMPIRSELDERMPSIKPTALRFSGSFGVEVTGITIQNSPQCHLKFDDCV
GVVVHDIAVSSPGDSPNTDGIHLQNTKDVLIHSTTLACGDDCISIQTGCSNVFVHNVNCG
PGHGISIGSLGKEGTKACVSNITVRDVAMHNTMTGVRIKTWQGGVGSVKGIIFSNIQLNQ
VQIPITINQFYCDHSKCKNQTSAVAVEGVTYERIKGTYTVKPVHFACSDNFPCVDVQLSS
IELKPVQEKYRMYDAYCWQTFGELNTPTLPPIDCLKIGKPPRNKVQSDHDVC

MITRESLTLRSITMMTLVTILVWSATLETCIARRGRHWRHHHRSSSSLSDSLSSKKPKSH
ENNHHHMSHKSKPKPKMKTQPPKSNDGSPVVSQPPQVQQPPPPHVQPPPTPLPLQPVEDS
QQFNVLDFGAKGDGMSDDTQAFEAAWASACKVEASTMIIPPDYIFLVGPISFSGPYCQAN
IVFQLEGMIVAPTDTESWGGGLMWWIEFTKLSGITIQGNGVIDGRGTVWWQQDYLSDYPI
DDDFKLIVPLNNSVQERPPMPIRSELNWRMPSIKPTALRFYGSIDVTVTGITIQNSPQCH
LKFDNCVKVLVHDVNVSSPGDSPNTDGIHLQNTRDVMIHTTTLACGDDCISIQTGCSNVY
VHNVNCGPGHGISIGSLGKDSTKACVSNITVRDVVMHNTMTGVRIKTWQGGIGSVKGILF
SNIQLTEVQLPIVIDQFYCDHSKCMNHTSAVSVEGVTYEKIRGTYTVKPVHFACSDSFPC
IDVQLSGIELKPVQLQYHMYDPFCWKTFGELNSATVPPIDCLQIGKPARNGVHSDHDICL

www.000webhost.com

Other information
Ka divergence:-0.138041KaKs divergence:-0.078424
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1599Length 2 (bp):1623Length divergence:0.007
MFE 1 (kcal):-491.01MFE 2 (kcal):-480.62MFE divergence-0.011