Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10650-AT1G60610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SBP (S-ribonuclease binding protein) family protein
Function (paralog2):SBP (S-ribonuclease binding protein) family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.0560395772885
Log2 mRNA fold difference:-0.66780277771594
Log2 TE fold difference:-0.3892285174314
Sequences
Protein sequence

MLSGNNGNTAPPVFMNENQLQYQTNLRSNQLHLLGNMGGGCTVDPVNYFANDNLVPMIRP
NKRGREAESISNNIQRQQQKLQMSLNYNYNNTSVREEVPKENLVSTGLRLSYDDDEHNSS
VTSASGSILAASPIFQSLDDSLRIDLHRQKDEFDQFIKIQAAQMAKGVRDMKQRHIASFL
TTLEKGVSKKLQEKDHEINDMNKKNKELVERIKQVAMEAQNWHYRAKYNESVVNVLKANL
QQAMSHNNSVIAAADQGKEGFGDSEIDDAASSYIDPNNNNNNNMGIHQRMRCKMCNVKEV
SVLIVPCRHLSLCKECDVFTKICPVCKSLKSSCVQVFFS

MLGGNNDNPVPQVLMNDSQFRYQSNTSLNQLHLLGTMRAGCTIDPVNYFANDNLAPMMRL
NSTRGRETENNNIMQRQQKLQISLNYNYNNNNTVVQDEVPKQNLVSTGLRLSYDDDERNS
SVTSANGSITTPVYQSLGDNIRLDLNRQNDELDQFIKFRADQMAKGVRDIKQRHVTSFVT
ALEKDVSKKLQEKDHEIESMNKKNRELVDKIKQVAVEAQNWHYKAKYNESVVNALKVNLQ
QVMSHGNDNNAVGGGVADHHQMKEGFGDSEIDDEAASYNYLNIPGMPSTGMRCKLCNVKN
VSVLLVPCRHLSLCKDCDVFTGVCPVCQSLKTSSVQVFFF

www.000webhost.com

Other information
Ka divergence:0.149274KaKs divergence:0.24836
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1020Length 2 (bp):1023Length divergence:0.001
MFE 1 (kcal):-279.23MFE 2 (kcal):-274.36MFE divergence-0.009