Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10670-AT1G60810
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ATP-citrate lyase A-1
Function (paralog2):ATP-citrate lyase A-2

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.45768369827771
Log2 mRNA fold difference:-0.78184114693483
Log2 TE fold difference:0.32255882042065
Sequences
Protein sequence

MARKKIREYDSKRLVKEHFKRLSGKELPIRSVQADDVFWLHSCFGFSDIRHHVINETTDL
NELVEKEPWLSSEKLVVKPDMLFGKRGKSGLVALKLDFADVATFVKERLGKEVEMSGCKG
PITTFIVEPFVPHNEEYYLNVVSDRLGCSISFSECGGIEIEENWDKVKTIFLPTGASLTP
EICAPLVATLPLEIKAEIEEFIKVIFTLFQDLDFTFLEMNPFTLVDGSPYPLDMRGELDD
TAAFKNFKKWGDIEFPLPFGRVMSPTESFIHGLDEKTSASLKFTVLNPKGRIWTMVAGGG
ASVIYADTVGDLGYASELGNYAEYSGAPKEDEVLQYARVVIDCATANPDGKSRALVIGGG
IANFTDVAATFNGIIRALKEKEAKLKAARMHIFVRRGGPNYQKGLAKMRALGDDIGVPIE
VYGPEATMTGICKEAIQYITAAA

MARKKIREYDSKRLVKEHFKRLSGQELPIRSVQINQETDLNELVEREPWLSSEKLVVKPD
MLFGKRGKSGLVALNLDFADVATFVKERLGKEVEMSGCKGPITTFIVEPFVPHNEEFYLN
IVSDRLGCSISFSECGGIDIEENWDKVKTITIPTGASLTFEICAPLVATLPLEIKGELED
FIQVIFTLFEDLDFTFLEMNPFTLVDGKPYPLDMRGELDDTAAFKNFKKWGDIEFPMPFG
RVMSSTESFIHGLDEKTSASLKFTVLNPKGRIWTMVAGGGASVIYADTVGDLGYASELGN
YAEYSGAPKEDEVLQYARVVIDCATANPDGKSRALVIGGGIANFTDVAATFNGIIRALKE
KEAKLKAARMHIFVRRGGPNYQKGLAKMRSLGDEIGVPIEVYGPEATMTGICKEAIQYIT
AAA

www.000webhost.com

Other information
Ka divergence:0.250826KaKs divergence:-0.0784672
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1332Length 2 (bp):1272Length divergence:-0.023
MFE 1 (kcal):-413.2MFE 2 (kcal):-399.38MFE divergence-0.017