Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10730-AT1G60780
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Clathrin adaptor complexes medium subunit family protein
Function (paralog2):Clathrin adaptor complexes medium subunit family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.4850077409242
Log2 mRNA fold difference:2.9318359281476
Log2 TE fold difference:-0.45679320309805
Sequences
Protein sequence

MAGAASALFLLDIKGRVLVWRDYRGDVTAAQAERFFTKLIETEGDSQSNDPVAYDNGVTY
MFVQHSNIYLMIASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM
MDFGYPQFTEARILSEFIKTDAYRMEVTQRPPMAVTNSVSWRSEGLKFKKNEVFLDVIES
VNILVNSNGQIVRSDVVGALKMRTYLSGMPECKLGLNDRILLEAQGRAIKGKAIDLEDIK
FHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLIWVEAHIERHSRSRVEMLVKA
RSQFKDRSYATSVEIELPVPTDAYNPDVRTSLGSAAYAPEKDALVWKIQYFYGNKEHTLK
ADFHLPSIAAEEATPERKAPIRVKFEIPKFIVSGIQVRYLKIIEKSGYQAHPWVRYITMA
GEYELRLM

MAGAASALFLLDIKGRVLVWRDYRGDVSAAQAERFFTKLIEKEGDSQSNDPVAYDNGVTY
MFVQHSNVYLMIASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM
MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVIEN
VNILVNSNGQIVRSDVVGALKMRTYLTGMPECKLGLNDRVLLEAQGRATKGKAIDLEDIK
FHQCVRLARFENDRTISFIPPDGAFDLMTYRLSTQVKPLIWVEAQIESHSRSRVEMLIKA
RSQFKERSTATNVEIELPVPTDASNPTVRTSLGSASYAPEKDALVWKIKSFPGNKEYMLR
AEFHLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYLKIIEKSGYQALPWVRYITMA
GEYELRLV

www.000webhost.com

Other information
Ka divergence:-0.602102KaKs divergence:-0.609241
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1287Length 2 (bp):1287Length divergence:0
MFE 1 (kcal):-389.52MFE 2 (kcal):-377.02MFE divergence-0.016