Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10820-AT1G60670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF3755)
Function (paralog2):Protein of unknown function (DUF3755)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.17008445382646
Log2 mRNA fold difference:-0.21669357991799
Log2 TE fold difference:0.029400256974361
Sequences
Protein sequence

MIPMDNHCLPSTSTTGLVFPTNYGVNAINASSGFHPAVDASGSVAAGVKQEAALVMDWSV
EEQYVLENGLAKLKDEPKISKYVKIAATLPDKTVRDVALRCRWMTRKRRKREDNNAAKNI
STRKVVDTSPELNMLSNVPQQNALYVLNNMCHSTRTPFEGLSDAVMDLLQQNAQAFSQIS
YNLSACKLQDNISLFHQARNNISAILTDMKEMPGIMSRMPALPVSINDDLASNLLSSTTQ
PISYNIPPSIHLKQEPRS

MIPMDNYCVPSTSTTGLVFSATSSMNASSGFHLTVNSPTSVTGLKHEASLAVDWSVEEQY
ILEKGLSKFKDEPQVTKYVKIAATLPDKSVRDVAMRCKWMTQKRRKGEEHSTGTKVSYRK
VVDLPPKLNMFSTEPQQNATYAMNHMCQSARMPFEGLSDAVMERLRQNAQAFSQISSNLS
VCKPQDNVSLFYMARNNISAILNDMKEMPGIISRMPPLPVSINNDLASSLVTSATQPRSY
TIPSSIYLKQEPRN

Other information
Ka divergence:-0.152411KaKs divergence:-0.0485153
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):777Length 2 (bp):765Length divergence:-0.008
MFE 1 (kcal):-213.09MFE 2 (kcal):-190MFE divergence-0.057