Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10850-AT1G60630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich repeat protein kinase family protein
Function (paralog2):Leucine-rich repeat protein kinase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.5906195654881
Log2 mRNA fold difference:-2.0220571474988
Log2 TE fold difference:0.2529997236762
Sequences
Protein sequence

MASSSSSSSSSTVSFVVFAFTVFFCLVTPARSSDVEALLSLKSSIDPSNSISWRGTDLCN
WQGVRECMNGRVSKLVLEYLNLTGSLNEKSLNQLDQLRVLSFKANSLSGSIPNLSGLVNL
KSVYLNDNNFSGDFPESLTSLHRLKTIFLSGNRLSGRIPSSLLRLSRLYTLNVEDNLFTG
SIPPLNQTSLRYFNVSNNKLSGQIPLTRALKQFDESSFTGNVALCGDQIGSPCGISPAPS
AKPTPIPKSKKSKAKLIGIIAGSVAGGVLVLILLLTLLIVCWRRKRRNQAPREDRKGKGI
AEAEGATTAETERDIERKDRGFSWERGEEGAVGTLVFLGTSDSGETVVRYTMEDLLKASA
ETLGRGTLGSTYKAVMESGFIVTVKRLKNARYPRMEEFKRHVEILGQLKHPNLVPLRAYF
QAKEERLLVYDYFPNGSLFTLIHGTRASGSGKPLHWTSCLKIAEDLASALLYIHQNPGLT
HGNLKSSNVLLGPDFESCLTDYGLSTLHDPDSVEETSAVSLFYKAPECRDPRKASTQPAD
VYSFGVLLLELLTGRTPFQDLVQEYGSDISRWVRAVREEETESGEEPTSSGNEASEEKLQ
ALLSIATVCVTIQPDNRPVMREVLKMVRDARAEAPFSSNSSEHSPGRWSDTVQSLPRDDQ
VSI

MISSSSCMFFLVFAFFLISPVRSSDVEALLSLKSSIDPSNSIPWRGTDPCNWEGVKKCMK
GRVSKLVLENLNLSGSLNGKSLNQLDQLRVLSFKGNSLSGSIPNLSGLVNLKSLYLNDNN
FSGEFPESLTSLHRLKTVVLSRNRFSGKIPSSLLRLSRLYTFYVQDNLFSGSIPPLNQAT
LRFFNVSNNQLSGHIPPTQALNRFNESSFTDNIALCGDQIQNSCNDTTGITSTPSAKPAI
PVAKTRSRTKLIGIISGSICGGILILLLTFLLICLLWRRKRSKSKREERRSKRVAESKEA
KTAETEEGTSDQKNKRFSWEKESEEGSVGTLVFLGRDITVVRYTMDDLLKASAETLGRGT
LGSTYKAVMESGFIITVKRLKDAGFPRMDEFKRHIEILGRLKHPNLVPLRAYFQAKEECL
LVYDYFPNGSLFSLIHGSKVSGSGKPLHWTSCLKIAEDLAMGLVYIHQNPGLTHGNLKSS
NVLLGPDFESCLTDYGLSDLHDPYSIEDTSAASLFYKAPECRDLRKASTQPADVYSFGVL
LLELLTGRTSFKDLVHKYGSDISTWVRAVREEETEVSEELNASEEKLQALLTIATACVAV
KPENRPAMREVLKMVKDARAEAALFSFNSSDHSPGRWSDTIQSLPREDHMSI

www.000webhost.com

Other information
Ka divergence:0.252295KaKs divergence:0.323763
GC content 1 (%):48GC content 2 (%):45GC content divergence:-0.032
Length 1 (bp):1992Length 2 (bp):1959Length divergence:-0.008
MFE 1 (kcal):-653.6MFE 2 (kcal):-610.84MFE divergence-0.034