Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10870-AT1G60860
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ARF-GAP domain 4
Function (paralog2):ARF-GAP domain 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.8274926950194
Log2 mRNA fold difference:-1.042555059634
Log2 TE fold difference:0.058933630077062
Sequences
Protein sequence

MATFINLEDSPMFQKQVCSLEGTADELKDRCQKLYKGVKKFMGTLGEASKGESAFAACLE
EFGGGPDDPISLSIGGPVISKFINALRELASYKEFLCSQVEHVLLERLMNFISVDLQEAK
ESRHRFDKAAHSYDQSREKFVSLKKNTRGEIVAELEEDLENSKSTFEKSRFNLVNSLMTI
EAKKKYEFLESISAIMDAHLRYFKLGYDLLNQLEPFIHQILTYAQQSKEQSKIEQDRLAR
RIQEFRTQSELDSQQLVANAESSGANGNRVGGNIPYKNTETSLTADKEVIKQGYLLKRSS
SLRTDWKRKFFVLDSHGSMYYYRTNGNKSMGSHHHYSGSSDHNTGVFGRFRARHNRSGSL
TEGSLGYNTIDLRTSLIKLDAEDMDLRLCFRIISPQKTYTLQAENGADRMDWVNKITKAI
GTLLNSHFLQQSPVRYLDKDNSSSAPANAVVSGDQIRHNDSRQNIGDDVSTILRGLPGNN
ACAECNAPEPDWASLNLGVLLCIQCSGVHRNLGVHISKVRSLSLDVKVWEPTILDLFRNL
GNVYCNSLWEGLLHLDDDCEDGSALSHASVSKPCPEDSFSVKEKYILGKYLEKALVIKDE
SEANLSAASRIWEAVQSRNIREIYRLIVTTGDVNIINTKFDDITDIDAYHHIDAAEKAVK
KRHDPTVCQRIKESNEPRSCLQGCSLLHVACHIGDSVLLELLLQFGADLNIRDYHGRTPL
HHCISSGNHKFAKILLRRGARPSIEDDGGLSVLERAMEMGAITDEELFLLLAECA

MAGFINLEDSPMFQKQVFSLEGTSDELKDRCQKLYKGVKKFMGALGEASTGVSAFADSLE
EFGAGHDDPVSVSIGGPVISKFINTLRELSSYKEFLRSQVEHVLLERLTNFMTVDLQEAK
ESRRRFDKAVHSYDQAREKFVSLKKNTRGDIVAELEEDLENSKSAFEKSRFNLVNSLMTI
EAKKKYEFLESISAIMDSHFKYFKLGYDLLSQLEPYIHQVLTYAQQSKEQSKIEQDRFAQ
RIQEFRTQSELDSQQASAKADPSDVGGNHVYRAIPRKNVEANSVSTADKEVTKQGYLLKR
SASLRADWKRRFFVLDNHGSLYYYRNTGNKSAKSQHYYSGLGEHSSGVFGRFRTRHNRSA
SQGSLDCNMIDLRTSLIKLDAEDTDLRLCFRIISPQKTYTLQAENGADRMDWVNKITAAI
TIRLNSHFLQQSPARYLDKKNTSSGPATENLTLNQKEDYNQRLNVGDDVLTILREIPGNN
TCAECNAPDPDWASLNLGVLMCIECSGVHRNLGVHISKVRSLTLDVKVWEPTILDLFRNL
GNGYCNSVWEELLHHLDDDSEKGSTDTLASVSKPSSEDWFTLKEKYINGKYLEKALVVKD
EREANSTASSRIWEAVQSRNIRDIYRLIVKADANIINTKFDDITDLDVYHHHHVDAPDEV
KKRHDPNACQRIKNSNEARNCLQGCSLLHVACQSGDPILLELLLQFGADINMRDYHGRTP
LHHCIASGNNAFAKVLLRRGARPSIEDGGGLSVLERAMEMGAITDEELFLLLAECQ

Other information
Ka divergence:-0.0646952KaKs divergence:0.501206
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):2328Length 2 (bp):2331Length divergence:0.001
MFE 1 (kcal):-684.49MFE 2 (kcal):-663.5MFE divergence-0.016