Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10900-AT1G60890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Phosphatidylinositol-4-phosphate 5-kinase family protein
Function (paralog2):Phosphatidylinositol-4-phosphate 5-kinase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.460779520839
Log2 mRNA fold difference:-2.0115467377522
Log2 TE fold difference:0.43318022094845
Sequences
Protein sequence

MDMRSGDREFPNGDFYSGEVKGIIPNGKGKYAWSDGTIYEGDWDEGKISGKGKLIWSSGA
KYEGDFSGGYLHGFGTMTSPDESVYSGAWRMNVRHGLGRKEYCNSDLYDGLWKEGLQDGR
GSYSWTNGNRYIGNWKKGKMCERGVMRWENGDLYDGFWLNGFRHGSGVYKFADGCLYYGT
WSRGLKDGKGVFYPAGTKQPSLKKWCRSLEYDDTGKFVLSRSASVNVEELRSLNTVTQSL
SVKTSAGETTCDPPRDFTCHGPVSKSARFSGSGQSEGQDKNRIVYEREYMQGVLIRETIM
SSVDRSHKIKPPNRPREVRARSLMTFLRGEHNYYLMLNLQLGIRYTVGKITPVPRREVRA
SDFGKNARTKMFFPRDGSNFTPPHKSVDFSWKDYCPMVFRNLRQMFKLDAAEYMMSICGD
DGLTEISSPGKSGSIFYLSHDDRFVIKTLKKSELQVLLRMLPKYYEHVGDHENTLITKFF
GVHRITLKWGKKVRFVVMGNMFCTELKIHRRYDLKGSTQGRFTEKIKIQEKTTLKDLDLA
YEFHMDKLLREALFKQIYLDCSFLESLNIIDYSLLLGLHFRAPGQLNDILEPPNAMSDQE
SVSSVDVGLTQEHSIPPKGLLLVTHEPNSVNTAPGPHIRGSTLRAFSVGEQEVDLILPGT
ARLRVQLGVNMPAQAHHKLIEDKEESATIELFEVYDVVVYMGIIDILQEYNTKKKVEHTC
KSLQYDPMTISVTEPSTYSKRFVNFLHKVFPEER

MGYCSMKSSWIGVSLMPAERVFSNGDVYSGQLKGTLPHGKGKYAWPDGIIYEGDWEEGKI
SGRGKLMWSSGAKYEGDFSGGYLHGFGTLTSPDGSVYAGAWRMNVRHGLGRKEYCNSDVY
DGSWREGLQDGSGSYSWYNGNRFIGNWKKGKMSGRGVMSWANGDLFNGFWLNGLRHGSGV
YKYADGGFYFGTWSRGLKDGSGVFYPAGSKHPSLKKWHRHFGYDDTGNFLLSHNSTINID
DLRTSKAVSRSLSELTTTSGLTRTSERYPDDYWSTSDPPRDFMHHGPSSKSARSVDSGQS
EIRDKNPIVFEREYMQGVLIKERIMSSIDMSHRARPLNLTKEVTVSACVSFLGGKWNHYL
MLNLQLGIRYTVGKITPVPPREVRASDFSERARIMMFFPRNGSQYTPPHKSIDFDWKDYC
PMVFRNLREMFKLDAADYMMSICGDDGLREISSPGKSGSIFYLSHDDRFVIKTLKRSELK
VLLRMLPRYYEHVGDYENTLITKFFGVHRIKLKWGKKVRFVVMGNMFCTELKIHRRYDLK
GSTQGRYTEKNKIGEKTTLKDLDLAYEFHMDKLLREALFKQIILDCSFLESLQILDYSLL
LGLHFRAPDPLTDILEPPNEMSDQESDSVGSVDVNLPREPSIPPKGLLMVTHEPNSVNTA
PGPHIRGSTLRAFSVGEKEVDLILPGTARLRVQLGVNMPAQAHHKLGQDNEESGTVELFE
VYDVVVYMGIIDILQEYNMKKKVEHTCKSMKYDPMTISAIEPTLYSKRFIDFLLKVFPEK
A

Other information
Ka divergence:-0.223649KaKs divergence:0.902575
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):2265Length 2 (bp):2346Length divergence:0.018
MFE 1 (kcal):-659.18MFE 2 (kcal):-687.64MFE divergence0.021