Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10930-AT1G60930
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DNA helicase (RECQl4A)
Function (paralog2):RECQ helicase L4B

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.7322456701318
Log2 mRNA fold difference:-3.6348265046449
Log2 TE fold difference:1.9628403342568
Sequences
Protein sequence

MINSNQMSRSHLPEVQKPRGPQTNWSEHAKALESSSSVTKFLSSNVLYALESQKPRDMAA
RSIAFPSVNVHTLAHPQISKAWRALSSLSVNNTYLRPGVTPPIDVGTNDSYSARERSTAK
VISSTGGSVYSSTRPNLSAMNVSGTGRSFHSFPSSVPGDDKIVAEKFPRGNNEIRESEPS
CTHLNGVEKSFGNSAFPAEQFESRKACLDDMDDDDILENIDVDQIVMEHYHSTSTPQPSV
SNFSLRTPPVDRSASRLEEECNLPPELCSNCSHGIKLGLCPEASTHVEQMKDVLLAISNE
LLDDATDLSPDRVGQLRQERLRLKKQIQQLENHIRDKESQKSQFLSSTATRIFQYETPKS
TNYKMDQPQTDFRAHVSDQGRYACDSWNTPRDSSFSVDRYGLSSAPVEREQYVPKIIDVT
YTEGSNDKKWSSREFPWTRKLEVNNKKVFGNHSFRPNQREIINATMSGSDVFVLMPTGGG
KSLTYQLPALICGGITLVISPLVSLIQDQIMNLLQANIPAASLSAGMEWAEQLKIFQELN
SEHSKYKLLYVTPEKVAKSDSLLRHLENLNSRGLLARFVIDEAHCVSQWGHDFRPDYQSL
GILKQKFPNIPVLALTATATASVKEDVVQALGLVNCVVFRQSFNRPNLWYSVVPKTKKCL
EDIDKFIKENHFDECGIIYCLSRMDCEKVSERLQEFGHKAAFYHGSMEPEQRAFIQTQWS
KDEINIICATVAFGMGINKPDVRFVIHHSLPKSIEGYHQECGRAGRDGQRSSCVLYYGYG
DYIRVKHMISQGGVDQSPMATGYNRVASSGRLLETNTENLLRMVRYCENEVECRRFLQLV
HLGEKFDSTNCKKTCDNCCSSQSLIDKDVTLITRQLVELVKQTGERFSSAHILEVYRGSL
NQMVKKHRHETLQFHGAGKHLSKIEVSRILHYLVTEDILVEDVRKSDMYGSVSSLLQVNN
AKATILFSGSQTIVMKFPSSVKVLKPSKQGATAAKGPLTSEKQSTLPLTTEDAPPKDVNL
SANMYTALRKLRTALVKEAPDGVMAYHIFINSTLQQISRRIPRTKEELLEINGLGKAKVS
KYGDQLLETIETTVNEYYGTNKKDSIISNDSPDSGKRRRDENISPNVAEDDDFEVSPSQS
CKKTVRNKSNEVLHGECIDGDRRGMELDFDFKDEDGSEIRPEGRVLPW

MVVTRGDKFAGSSLACKSMIGANKMSGSHLHEVNNSRSHFPQTNWLKVAKAFECIPSLNK
FMGSNFLYSLESQKLGRDREMAARSIENIAPVTVQTLARPQIEKAWCTLINLSINNTYLR
PGITPAIDNDSTSRTSSTKGSTFKVTSNADGSFCAHNHPEHSQRSVRGTAKSIDSFSSSS
VGDNKIIIDKVPRVNYEVRDSVTVTNGMEMPPIKNSAQLARPVEPREVSLGEIDYDDIME
IIDVDQIAMEHCPSTCTKQPSVSKFVDIFTSRREEEQGLPPEICSNCSHGIKLGLCPEAS
THVEQMKDTLLAISNEILDNTYDLGPDHVEQLHQKRLLLKKQIQQLEILIHNKERKKSQC
LVSIPSHNTQYETPQTTNLEVVYGQTDSPTHVKEQGRCVTDNWNMPRDYLVSKERYDISS
GSEEREQSVSEVIDVTDTESSNDKKWTSSDFPWTKNLEVYNKLVFGNHSFRPNQREIINA
TMSGCDVFVLMPTGGGKSLTYQLPALLCAGITLVISPLVSLIQDQIMNLLQTNISAASLS
AGMEWAEQLEILQELSSEKSKYKLLYVTPEKVAKSESLLRHLEILNSRSLLARFVIDEAH
CVSQWGHDFRPDYQGLGVLKQKFPNIPMLALTATATTSVKEDVVQALGLVNCVVFRQSFN
RPNLWYSVVPKTNKCLEDIDKFIRENHFDECGIIYCLSRMDCEKVTEALRVFGHKAAFYH
GSMDPGKRAFVQKQWSKDEINIICATVAFGMGINKPDVRFVIHHSLPKSIEGYHQECGRA
GRDGQRSSCVLYYSYTDYIRVKHMISQGGLGQGQMKMGYNCKASSGRMLETNTENLLRMV
SYCENEVDCRRFLQLVHLGEKFDSTNCKNTCDNCSSSKILIDKDVTVIARQLVALVKLTG
ERFSSAHIVEIYRGSLNQSVKRNRQDTLHLHGAGKHLTKSEASRILHYLVTEDILAEGVK
KSELYGSVSSLLKVNRSKAASLLSGGQSITMRFPSTIKVSKQSKSTANPAKVPLKQTTLP
MAKAAPQDSNLSGILLTALKNLRTDIVKESPDLVMAYHIFGNATLKEISKRLPRTKEELL
DINGLGKAKVSKYGDRLLETIDSTINDHYKTRPGSGKRRRDENVNPNVAEDDDPDWSASQ
SHKKVVKNKK

www.000webhost.com

Other information
Ka divergence:0.149166KaKs divergence:0.0248924
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):3567Length 2 (bp):3453Length divergence:-0.016
MFE 1 (kcal):-1027.6MFE 2 (kcal):-966.67MFE divergence-0.031