Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10940-AT1G60940
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):SNF1-related protein kinase 2.10

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.14401473874597
Log2 mRNA fold difference:0.19307991961666
Log2 TE fold difference:-0.25226265572672
Sequences
Protein sequence

MDKYELVKDIGAGNFGVARLMKVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI
IRFKEVVLTPTHLAIAMEYAAGGELFERICSAGRFSEDEEEGNKRKHARYFFQQLISGVS
YCHAMQICHRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSRPKSTVGTPAYIAPEVLS
RREYDGKMADVWSCGVTLYVMLVGAYPFEDQEDPKNFRKTIQKIMAVQYKIPDYVHISQD
CKNLLSRIFVANSLKRITIAEIKKHSWFLKNLPRELTETAQAAYFKKENPTFSLQTVEEI
MKIVADAKTPPPVSRSIGGFGWGGNGDADGKEEDAEDVEEEEEEVEEEEDDEDEYDKTVK
EVHASGEVRIS

MDKYELVKDIGAGNFGVARLMRVKNSKELVAMKYIERGPKIDENVAREIINHRSLRHPNI
IRFKEVVLTPTHIAIAMEYAAGGELFERICSAGRFSEDEARYFFQQLISGVSYCHAMQIC
HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSMPKSTVGTPAYIAPEVLSRGEYDGKM
ADVWSCGVTLYVMLVGAYPFEDQEDPKNFKKTIQRIMAVKYKIPDYVHISQDCKHLLSRI
FVTNSNKRITIGDIKKHPWFLKNLPRELTEIAQAAYFRKENPTFSLQSVEEIMKIVEEAK
TPARVSRSIGAFGWGGGEDAEGKEEDAEEEVEEVEEEEDEEDEYDKTVKQVHASMGEVRV
S

www.000webhost.com

Other information
Ka divergence:0.0730135KaKs divergence:-0.220233
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1116Length 2 (bp):1086Length divergence:-0.014
MFE 1 (kcal):-321.45MFE 2 (kcal):-317.14MFE divergence-0.007