Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10960-AT1G60950
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ferredoxin 1
Function (paralog2):2Fe-2S ferredoxin-like superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:3.1172089611648
Log2 mRNA fold difference:2.6666451715323
Log2 TE fold difference:0.44177416647478
Sequences
Protein sequence

MASTALSSAIVSTSFLRRQQTPISLRSLPFANTQSLFGLKSSTARGGRVTAMATYKVKFI
TPEGEQEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDEQ
MSEGYVLTCVAYPTSDVVIETHKEEAIM

MASTALSSAIVGTSFIRRSPAPISLRSLPSANTQSLFGLKSGTARGGRVTAMATYKVKFI
TPEGELEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQ
IGEGFVLTCAAYPTSDVTIETHKEEDIV

Other information
Ka divergence:-0.141995KaKs divergence:-0.997966
GC content 1 (%):53GC content 2 (%):49GC content divergence:-0.039
Length 1 (bp):447Length 2 (bp):447Length divergence:0
MFE 1 (kcal):-137.93MFE 2 (kcal):-124.62MFE divergence-0.051