Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G10970-AT1G60960
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):zinc transporter 4 precursor
Function (paralog2):iron regulated transporter 3

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.3004823565464
Log2 mRNA fold difference:2.4077504361948
Log2 TE fold difference:-0.45202859321554
Sequences
Protein sequence

MIFVDVLWKLFPLYSFGSGRDSLSESILQIIPETMASSTTKILCDAGESDLCRDDSAAFL
LKFVAIASILLAGAAGVAIPLIGRNRRFLQTEGNLFVAAKAFAAGVILATGFVHMLAGGT
EALSNPCLPDFPWSKFPFPGFFAMVAALATLLVDFMGTQYYERKQERNQAATEAAAGSEE
IAVVPVVGERVTDNKVFGEEDGGGIHIVGIRAHAAHHRHSHSNSHGTCDGHAHGHSHGHM
HGNSDVENGARHVVVSQILELGIVSHSIIIGLSLGVSQSPCTIRPLIAALSFHQFFEGFA
LGGCISQAQFRNKSATIMACFFALTTPLGIGIGTAVASSFNSHSPGALVTEGILDSLSAG
ILVYMALVDLIAADFLSKRMSCNLRLQVVSYVMLFLGAGLMSALAIWA

MFFVDVLWKLVPLYLFGSETKSLSATESILQIVPEAMAATSSNVLCNASESDLCRDDSAA
FLLKFVAIASILLAGAAGVTIPLIGRNRRFLQTDGNLFVTAKAFAAGVILATGFVHMLAG
GTEALKNPCLPDFPWSKFPFPGFFAMIAALITLFVDFMGTQYYERKQEREASESVEPFGR
EQSPGIVVPMIGEGTNDGKVFGEEDSGGIHIVGIHAHAAHHRHSHPPGHDSCEGHSKIDI
GHAHAHGHGHGHGHGHVHGGLDAVNGARHIVVSQVLELGIVSHSIIIGLSLGVSQSPCTI
RPLIAALSFHQFFEGFALGGCISQAQFRNKSATIMACFFALTTPIGIGIGTAVASSFNSH
SVGALVTEGILDSLSAGILVYMALVDLIAADFLSTKMRCNFRLQIVSYVMLFLGAGLMSS
LAIWA

Other information
Ka divergence:0.074726KaKs divergence:-0.863592
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1227Length 2 (bp):1278Length divergence:0.02
MFE 1 (kcal):-404.6MFE 2 (kcal):-408.7MFE divergence0.005