Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G11060-AT1G61030
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):WAPL (Wings apart-like protein regulation of heterochromatin) protein
Function (paralog2):WAPL (Wings apart-like protein regulation of heterochromatin) protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.40357079990574
Log2 mRNA fold difference:0.17008068977083
Log2 TE fold difference:-0.52399374119281
Sequences
Protein sequence

MIIVKLTANRICCSLLQLRRSYEHFYIFVFLPEIPLFRFSHLKLFPKNLQIQRLVSAMME
RTYGRRKPGIPRTLSDSLNDSVSQTEYLSSSSSPDIEPIDYSLLPFSSQESSSLWHSSSR
SNFREDYPQNGGVVRRAKRVRNGAEAAAFTSTLLEAQEFGELMEHEDEVNFALDGLRKGH
QLRIRRASLSSLLSICASQHQRRSLRAQGISQSIIDAILVLSLDDIPSNLAAATLFFALT
ADGQDEHFMESPKCIKFLIKLLKPVIVTSTEGKPRNIGFKLLSLLKDVDAARDPVKMDDP
SSSDILSRVQELLVNCKEMRLNDSYITETTRPELSTKWVALLAMERACVSKISFDDTSGS
VKKTGGNFKEKLRELGGLDAVLEVVMDCHAVMERWVEYDALSVQEKKDNLHKQSLMLLLK
CLKIMENATFLSTDNQNHLLGFKKCLGSHDSRMSFTELTISVIKMLSGLHLRGGFSSPNT
NNVNSHYSNGGNHDSVLEANRKVTNEVVTISSDTYSTVGSISTRNGSVSQRSQSIIHLDF
SPTSMSGSQSSVSGNEPTTSKTRVGSTISGSFAGRLASLGSDIARTTLRTTQAGEPICKK
FGEFAPPEESEDPFAFDLEDYKPSKWAVVSVNQKKSRAQKKKGCYKQSKDESLYQLFSSQ
EESSNHRLNSQEESSNRDCSTSLQPSHCTNDIDEECLCLLFDCLLTAVKVLMNLTNDNVV
GCRQVGGCRGLESMAELIARHFPSFTRSQLFSEMEKTGSSHQKKDKYLTDQELDFLVAIL
GLLVNLVERDGVNRSRLASASVPITKPEELQESEQEMIPLLCSIFLTNQGSAETKEETTT
FTLDDEEAVLEGEKEAEKMIVEAYSALLLAFLSTESRSIRNSIKDYLPKRNLAILVPVLE
RFVAFHMTLNMIPPETHKAVMGVIESCKSP

MMERTYGRRKPGMLNDDVSRAEHIFPSSSSPELEPVDFSTQESSCVWNYSSRSTFSDNDF
SEKRNKRPRNGGGGFGSNSTLMEAQEFGELIENEDEVNFALDGLKKGHKVRIRRAALSSL
LSICESQYQRRSLRALGISQSIIDAILGLCLDDIPSNLAAATLFFVLTTDGQDDHFMESP
NSIKFLVKLLRPVVSASTKVKPRNIGSRLLSIIKDVDAARDAASMHDLSSCDIIDRAQEI
LVNCKELRLIDSYKIERMRPELSTKWVALLVMEKACLSKISFDDTSGTVKKSGGMFKEKL
RELGGLDAVFDVVMDCHTVMESWVTHDTLSVEDIKDDLNKQSLMLLLKCLKIMENATFLS
TENQIHLLRLNKSMGSHESRLSFTELMISVIKILSGLQLRAHRNEKHPHPQPHLASAVKK
GFVTIISSDTCSTTGFSSIKSLSVSKRNQSAFLVGCSTTPKPGSQSSVMSTIDHCTLTTT
AGSNTGSFAGRLASLGSGISRSKTRTSQTRESSCKKVENFASFEDSQDPFSFDLEDSGPS
RWAVGKQKKSKGQKRKGSYRDKKDERSLQLFSSQEESNHGLNSQEESSDRDHHVTEQPSL
TYDIDKGCLCLLSDCLLTAVKVLMNLTNGNSVGCREVAACGGLESMAELVVGHFPSFTRS
PLYSQMESGTCHQKDKHLTDQELDFLVAILGLLVNLVEKNGINRSRLAAASVPITNPEGL
QDSEQDMIPLLCSIFLTNKGSADTKDETSTFTLDDEEAVLESEKEAEKMIVEAYSALLLA
FLSTESRSIRNAIRDYLPKRDMAILVPVLDRFVAFHTTLDMIPPETHKVVMEVIESCKLP

www.000webhost.com

Other information
Ka divergence:0.253208KaKs divergence:0.0861595
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):2793Length 2 (bp):2523Length divergence:-0.051
MFE 1 (kcal):-847.67MFE 2 (kcal):-761.3MFE divergence-0.054