Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G11080-AT1G61130
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):serine carboxypeptidase-like 31
Function (paralog2):serine carboxypeptidase-like 32

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.81861626473241
Log2 mRNA fold difference:-1.8003172527195
Log2 TE fold difference:0.89076436044885
Sequences
Protein sequence

MDNYQTKNISNLLTSLCFTTLLILAPVVICTRQHRFDSPKRSLLANEQDLVTGLPGQPDV
SFRHYAGYVPVDESNGRAMFYWFFEAMDLPKEKPLVLWLNGGPGCSSVGYGATQEIGPFL
VDTNGNGLNFNPYAWNKEANMLFLESPVGVGFSYSNTSSDYQKLGDDFTARDAYTFLCNW
FEKFPEHKENTFYIAGESYAGKYVPELAEVVYDNNNNNKKNGSSFHINLKGILLGNPETS
DAEDWRGWVDYAWSHAVISDETHRIITRTCNFSSDNTWSNDECNEAVAEVLKQYHEIDIY
SIYTSVCIGDSARSSYFDSAQFKTNSRISSKRMPPRLMGGYDPCLDDYARVFYNRADVQK
SLHASDGVNLKNWSICNMEIFNNWTGSNPSVLPIYEKLIAGGLRIWVYSGDTDGRVPVLA
TRYSLNALELPIKTAWRPWYHEKQVSGWLQEYEGLTFATFRGAGHAVPCFKPSSSLAFFS
AFLSGVPPPPSRHTR

MMNISNVSIALYLCTLFAFVSSDSPEAMRDLVTNFPGQPKVSFRHYAGYVTVNIISGRAL
FYWFFEAMTHPNVKPLVLWLNGGPGCSSVGYGATQEIGPFLVDNKGNSLKFNPYAWNKEA
NILFLESPAGVGFSYSNTSSDYRKLGDDFTARDSYTFLQKWFLRFPAYKEKDFFIAGESY
AGKYVPELAEVIYDKNKDNENLSLHINLKGILLGNPLTSYAEDWTGWVDYAWNHAVVSDE
TYRVIKQSCNFSSDTTWDVKDCKEGVDEILKQYKEIDQFSLYTPICMHHSSKVDSYANYK
TTIPRLFDGFDPCLDDYAKVFYNRADVQKALHATDGVHLKNWTICNDDILNHWNWTDSKR
SVLPIYKKLIAGGFRVWVYSGDTDGRVPVLSTRYCINKLELPIKTAWRPWYHETQVSGWF
QEYEGLTFATFRGAGHDVPSFKPSESLAFFSAFLNGVPPPLSR

www.000webhost.com

Other information
Ka divergence:0.148533KaKs divergence:0.2376
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):1488Length 2 (bp):1392Length divergence:-0.033
MFE 1 (kcal):-432.12MFE 2 (kcal):-376.7MFE divergence-0.069